Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5T101

Protein Details
Accession A0A1Z5T101    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
28-59KIKIKIKAPKTPFRKSFRRPKQHKTCRFLQLPHydrophilic
NLS Segment(s)
PositionSequence
22-49KAIEASKIKIKIKAPKTPFRKSFRRPKQ
Subcellular Location(s) mito 17.5, cyto_mito 11.5, cyto 4.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MAPVRKTINEPTRRSERLGLSKAIEASKIKIKIKAPKTPFRKSFRRPKQHKTCRFLQLPGELRNQIYRYALVSDKAIEITPTGPGEPPLLSTCVTIRRETKGIYYPENSFRLLLMNYNGAAFSDFYWQSRLWQFRRHSAAKNITFQLGGRPNWANLVEWIKDGYYGCGPPLRPDLDEPKCRDDHVVGAAFRIAEELEFKVCWVTIEKALEAYHWGLKGTCSRWARDGESGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.62
3 0.6
4 0.6
5 0.6
6 0.56
7 0.49
8 0.5
9 0.48
10 0.41
11 0.36
12 0.28
13 0.27
14 0.31
15 0.35
16 0.35
17 0.38
18 0.43
19 0.5
20 0.56
21 0.62
22 0.63
23 0.66
24 0.72
25 0.76
26 0.79
27 0.78
28 0.8
29 0.8
30 0.83
31 0.84
32 0.87
33 0.86
34 0.88
35 0.91
36 0.91
37 0.92
38 0.88
39 0.85
40 0.83
41 0.78
42 0.71
43 0.64
44 0.61
45 0.57
46 0.55
47 0.51
48 0.42
49 0.39
50 0.39
51 0.36
52 0.28
53 0.23
54 0.19
55 0.16
56 0.18
57 0.18
58 0.15
59 0.14
60 0.14
61 0.13
62 0.13
63 0.11
64 0.09
65 0.08
66 0.08
67 0.09
68 0.08
69 0.08
70 0.08
71 0.08
72 0.09
73 0.09
74 0.1
75 0.1
76 0.11
77 0.1
78 0.11
79 0.12
80 0.17
81 0.19
82 0.2
83 0.2
84 0.23
85 0.24
86 0.24
87 0.26
88 0.26
89 0.27
90 0.27
91 0.28
92 0.27
93 0.3
94 0.31
95 0.28
96 0.22
97 0.19
98 0.18
99 0.16
100 0.14
101 0.1
102 0.09
103 0.08
104 0.08
105 0.08
106 0.06
107 0.06
108 0.06
109 0.05
110 0.09
111 0.09
112 0.09
113 0.12
114 0.12
115 0.14
116 0.19
117 0.25
118 0.23
119 0.31
120 0.33
121 0.38
122 0.46
123 0.47
124 0.47
125 0.49
126 0.56
127 0.52
128 0.54
129 0.47
130 0.4
131 0.37
132 0.32
133 0.31
134 0.27
135 0.23
136 0.22
137 0.22
138 0.22
139 0.24
140 0.24
141 0.18
142 0.15
143 0.19
144 0.16
145 0.15
146 0.16
147 0.13
148 0.14
149 0.14
150 0.13
151 0.12
152 0.11
153 0.12
154 0.15
155 0.15
156 0.17
157 0.21
158 0.21
159 0.2
160 0.24
161 0.32
162 0.37
163 0.44
164 0.46
165 0.47
166 0.46
167 0.45
168 0.44
169 0.36
170 0.31
171 0.29
172 0.3
173 0.24
174 0.24
175 0.24
176 0.21
177 0.19
178 0.16
179 0.11
180 0.06
181 0.08
182 0.08
183 0.09
184 0.09
185 0.1
186 0.1
187 0.1
188 0.11
189 0.13
190 0.15
191 0.18
192 0.21
193 0.21
194 0.22
195 0.22
196 0.22
197 0.21
198 0.2
199 0.19
200 0.17
201 0.17
202 0.16
203 0.18
204 0.25
205 0.24
206 0.3
207 0.3
208 0.33
209 0.37
210 0.42
211 0.44