Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5TT51

Protein Details
Accession A0A1Z5TT51    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-34STRANSLYRRHTRQNQICEPIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR012674  Calycin  
IPR022271  Lipocalin_ApoD  
IPR047202  Lipocalin_Blc-like  
IPR022272  Lipocalin_CS  
IPR000566  Lipocln_cytosolic_FA-bd_dom  
Pfam View protein in Pfam  
PF08212  Lipocalin_2  
PROSITE View protein in PROSITE  
PS00213  LIPOCALIN  
CDD cd19438  lipocalin_Blc-like  
Amino Acid Sequences MLGKATVACALLASTRANSLYRRHTRQNQICEPINEVAPALWDKQCFYPPPTENFDVNAYLGRWYQVAGNPASFTAACDGCIFAEYGLNENGTVAVTNGCQRDTPAGPVPVRVNGTATPAPRAYGNEGVFTVNFPFPTSGADVEGSEGSCPGPNYIVQAFDDYRGWALVQSSNFTTLFVLSREQQRTSMEIDQWLAIAEELGSDISNVVRYNQTGCTAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.13
4 0.15
5 0.18
6 0.23
7 0.32
8 0.41
9 0.47
10 0.55
11 0.63
12 0.73
13 0.79
14 0.82
15 0.8
16 0.78
17 0.76
18 0.68
19 0.63
20 0.54
21 0.45
22 0.35
23 0.27
24 0.19
25 0.16
26 0.16
27 0.14
28 0.14
29 0.13
30 0.15
31 0.18
32 0.22
33 0.23
34 0.24
35 0.31
36 0.32
37 0.37
38 0.42
39 0.43
40 0.39
41 0.39
42 0.38
43 0.3
44 0.26
45 0.23
46 0.16
47 0.14
48 0.13
49 0.11
50 0.09
51 0.09
52 0.11
53 0.12
54 0.14
55 0.14
56 0.14
57 0.14
58 0.14
59 0.15
60 0.12
61 0.1
62 0.1
63 0.09
64 0.09
65 0.09
66 0.09
67 0.08
68 0.09
69 0.08
70 0.05
71 0.07
72 0.06
73 0.08
74 0.08
75 0.08
76 0.08
77 0.07
78 0.07
79 0.06
80 0.06
81 0.04
82 0.04
83 0.04
84 0.08
85 0.08
86 0.08
87 0.08
88 0.09
89 0.12
90 0.12
91 0.15
92 0.16
93 0.19
94 0.19
95 0.21
96 0.21
97 0.2
98 0.2
99 0.17
100 0.15
101 0.12
102 0.16
103 0.16
104 0.16
105 0.16
106 0.15
107 0.15
108 0.14
109 0.15
110 0.14
111 0.18
112 0.18
113 0.17
114 0.17
115 0.17
116 0.17
117 0.16
118 0.14
119 0.09
120 0.09
121 0.08
122 0.08
123 0.08
124 0.1
125 0.1
126 0.09
127 0.09
128 0.1
129 0.09
130 0.1
131 0.1
132 0.09
133 0.07
134 0.07
135 0.06
136 0.07
137 0.07
138 0.07
139 0.07
140 0.07
141 0.11
142 0.11
143 0.12
144 0.12
145 0.15
146 0.15
147 0.15
148 0.16
149 0.13
150 0.12
151 0.11
152 0.11
153 0.09
154 0.1
155 0.12
156 0.12
157 0.14
158 0.14
159 0.17
160 0.17
161 0.16
162 0.15
163 0.12
164 0.13
165 0.12
166 0.13
167 0.14
168 0.23
169 0.26
170 0.27
171 0.28
172 0.29
173 0.3
174 0.33
175 0.34
176 0.28
177 0.26
178 0.26
179 0.24
180 0.22
181 0.2
182 0.15
183 0.1
184 0.08
185 0.06
186 0.05
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.06
193 0.08
194 0.08
195 0.1
196 0.13
197 0.14
198 0.17
199 0.19