Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5SN97

Protein Details
Accession A0A1Z5SN97   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MATLRRRVRHRARRLHGKRVDQLABasic
NLS Segment(s)
PositionSequence
5-19RRRVRHRARRLHGKR
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR045097  Thymidate_synth/dCMP_Mease  
IPR023451  Thymidate_synth/dCMP_Mease_dom  
IPR036926  Thymidate_synth/dCMP_Mease_sf  
IPR000398  Thymidylate_synthase  
Gene Ontology GO:0004799  F:thymidylate synthase activity  
GO:0006231  P:dTMP biosynthetic process  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF00303  Thymidylat_synt  
Amino Acid Sequences MATLRRRVRHRARRLHGKRVDQLAEVVRKLRHNPYDRRMILSAWNPADLRQDGSPALSHVCAILRVIPASTETKGRPAHPPLPTLLRHGSRRPLQHRLLRPAHAHPLPHLRPRPGTLTHTMGDAHIYLDHSEALQTQITREPREFPTLEISERMVPGQCEVDSEWKVEDFEVRGYVPHKGIAMKMSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.88
4 0.86
5 0.82
6 0.79
7 0.72
8 0.61
9 0.57
10 0.53
11 0.49
12 0.42
13 0.38
14 0.33
15 0.34
16 0.37
17 0.42
18 0.44
19 0.48
20 0.56
21 0.59
22 0.66
23 0.64
24 0.64
25 0.57
26 0.49
27 0.46
28 0.42
29 0.42
30 0.32
31 0.33
32 0.27
33 0.27
34 0.3
35 0.25
36 0.23
37 0.17
38 0.17
39 0.15
40 0.16
41 0.15
42 0.11
43 0.12
44 0.09
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.09
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.11
57 0.12
58 0.13
59 0.12
60 0.18
61 0.2
62 0.22
63 0.26
64 0.3
65 0.36
66 0.35
67 0.36
68 0.32
69 0.35
70 0.34
71 0.32
72 0.31
73 0.28
74 0.29
75 0.3
76 0.35
77 0.35
78 0.42
79 0.43
80 0.45
81 0.48
82 0.52
83 0.55
84 0.57
85 0.56
86 0.52
87 0.5
88 0.45
89 0.45
90 0.39
91 0.34
92 0.28
93 0.34
94 0.33
95 0.38
96 0.39
97 0.35
98 0.35
99 0.37
100 0.4
101 0.33
102 0.34
103 0.31
104 0.31
105 0.29
106 0.27
107 0.25
108 0.2
109 0.18
110 0.14
111 0.1
112 0.07
113 0.08
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.08
122 0.08
123 0.09
124 0.15
125 0.18
126 0.2
127 0.21
128 0.24
129 0.26
130 0.32
131 0.31
132 0.27
133 0.32
134 0.31
135 0.31
136 0.28
137 0.27
138 0.23
139 0.23
140 0.23
141 0.16
142 0.14
143 0.15
144 0.16
145 0.14
146 0.14
147 0.15
148 0.21
149 0.2
150 0.21
151 0.21
152 0.19
153 0.19
154 0.18
155 0.19
156 0.14
157 0.15
158 0.16
159 0.15
160 0.16
161 0.18
162 0.21
163 0.2
164 0.2
165 0.2
166 0.19
167 0.21