Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AJR4

Protein Details
Accession G3AJR4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
47-80LMHVQLWFKRRKKHNHKNRHKKSKQTHTNHTLENHydrophilic
NLS Segment(s)
PositionSequence
55-70KRRKKHNHKNRHKKSK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG spaa:SPAPADRAFT_59376  -  
Amino Acid Sequences MENPSIKTDTKTNTQKNAGRHGRARKVSNSSIESDVVIIGSGLAASLMHVQLWFKRRKKHNHKNRHKKSKQTHTNHTLENVAIDSETY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.63
3 0.62
4 0.68
5 0.67
6 0.63
7 0.64
8 0.66
9 0.67
10 0.69
11 0.68
12 0.64
13 0.63
14 0.6
15 0.58
16 0.51
17 0.45
18 0.4
19 0.35
20 0.29
21 0.22
22 0.18
23 0.12
24 0.09
25 0.05
26 0.03
27 0.03
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.08
39 0.15
40 0.24
41 0.28
42 0.37
43 0.46
44 0.58
45 0.69
46 0.77
47 0.81
48 0.84
49 0.91
50 0.93
51 0.96
52 0.96
53 0.93
54 0.92
55 0.92
56 0.92
57 0.91
58 0.89
59 0.88
60 0.86
61 0.83
62 0.75
63 0.67
64 0.57
65 0.47
66 0.39
67 0.29
68 0.2