Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AJ30

Protein Details
Accession G3AJ30    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
100-120ELWGKRTKSNNANSSKKRRLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, mito_nucl 13.666, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
KEGG spaa:SPAPADRAFT_149578  -  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSSLSNRVMNMKFMQKADDLKISEEREQNQKKIADLSEWVLPYSKSLLKMAQSKPKIESVGYGSIMSAPTRRSWGTKVEQEATPSPEKEASKNKSEDLNELWGKRTKSNNANSSKKRRLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.35
4 0.35
5 0.37
6 0.31
7 0.3
8 0.35
9 0.35
10 0.38
11 0.38
12 0.37
13 0.41
14 0.46
15 0.45
16 0.45
17 0.43
18 0.39
19 0.38
20 0.36
21 0.27
22 0.23
23 0.23
24 0.21
25 0.2
26 0.19
27 0.16
28 0.15
29 0.13
30 0.15
31 0.15
32 0.12
33 0.13
34 0.15
35 0.18
36 0.26
37 0.3
38 0.36
39 0.36
40 0.36
41 0.37
42 0.38
43 0.35
44 0.27
45 0.24
46 0.19
47 0.19
48 0.18
49 0.16
50 0.13
51 0.13
52 0.13
53 0.12
54 0.09
55 0.07
56 0.08
57 0.11
58 0.12
59 0.13
60 0.15
61 0.21
62 0.26
63 0.3
64 0.34
65 0.34
66 0.34
67 0.36
68 0.36
69 0.34
70 0.32
71 0.27
72 0.24
73 0.26
74 0.26
75 0.28
76 0.36
77 0.36
78 0.4
79 0.42
80 0.43
81 0.44
82 0.45
83 0.43
84 0.37
85 0.41
86 0.37
87 0.36
88 0.38
89 0.37
90 0.38
91 0.4
92 0.44
93 0.44
94 0.49
95 0.58
96 0.63
97 0.68
98 0.76
99 0.8
100 0.83