Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H8ZEP5

Protein Details
Accession H8ZEP5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
172-199QIRQNQRDSRDPKKRNEFLKKTIEKRGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038664  Gar1/Naf1_Cbf5-bd_sf  
IPR009000  Transl_B-barrel_sf  
Amino Acid Sequences MARGNNNANTKGGGKGQRDFPQMRFGKRENKEDPANFIKIGEYSHPVKNTNMIVIRLTENIVPYFNAGIYGEGERKIADIHEIFGKFDDHVYASITIDGKLDISKYQPGSIFRADKFRCLSFDRVKGANTHTPKNAAPKKAANLPQQFNRGRSSKYRTNAQNEKVRQYADSQIRQNQRDSRDPKKRNEFLKKTIEKRGSEIKMNRRTTFTYDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.44
4 0.49
5 0.55
6 0.55
7 0.5
8 0.53
9 0.54
10 0.54
11 0.53
12 0.51
13 0.54
14 0.57
15 0.64
16 0.59
17 0.61
18 0.64
19 0.59
20 0.61
21 0.57
22 0.53
23 0.43
24 0.38
25 0.32
26 0.24
27 0.24
28 0.19
29 0.18
30 0.19
31 0.23
32 0.25
33 0.26
34 0.26
35 0.29
36 0.28
37 0.28
38 0.27
39 0.24
40 0.22
41 0.22
42 0.23
43 0.19
44 0.19
45 0.15
46 0.13
47 0.13
48 0.12
49 0.11
50 0.1
51 0.1
52 0.08
53 0.08
54 0.07
55 0.07
56 0.08
57 0.09
58 0.1
59 0.09
60 0.1
61 0.09
62 0.09
63 0.09
64 0.08
65 0.09
66 0.08
67 0.09
68 0.13
69 0.14
70 0.14
71 0.14
72 0.14
73 0.11
74 0.11
75 0.11
76 0.07
77 0.07
78 0.08
79 0.08
80 0.08
81 0.09
82 0.09
83 0.09
84 0.08
85 0.08
86 0.07
87 0.06
88 0.06
89 0.06
90 0.07
91 0.09
92 0.1
93 0.11
94 0.13
95 0.15
96 0.17
97 0.21
98 0.23
99 0.2
100 0.29
101 0.28
102 0.3
103 0.31
104 0.28
105 0.28
106 0.28
107 0.34
108 0.31
109 0.35
110 0.35
111 0.34
112 0.33
113 0.32
114 0.34
115 0.34
116 0.32
117 0.31
118 0.28
119 0.3
120 0.31
121 0.39
122 0.41
123 0.36
124 0.37
125 0.38
126 0.4
127 0.45
128 0.51
129 0.5
130 0.51
131 0.53
132 0.54
133 0.58
134 0.57
135 0.51
136 0.49
137 0.43
138 0.4
139 0.43
140 0.45
141 0.45
142 0.47
143 0.54
144 0.56
145 0.62
146 0.67
147 0.67
148 0.69
149 0.65
150 0.65
151 0.59
152 0.53
153 0.44
154 0.39
155 0.4
156 0.39
157 0.42
158 0.42
159 0.47
160 0.54
161 0.56
162 0.59
163 0.56
164 0.54
165 0.57
166 0.59
167 0.62
168 0.65
169 0.7
170 0.74
171 0.78
172 0.8
173 0.81
174 0.85
175 0.83
176 0.8
177 0.84
178 0.83
179 0.78
180 0.81
181 0.78
182 0.69
183 0.66
184 0.68
185 0.62
186 0.62
187 0.64
188 0.65
189 0.67
190 0.72
191 0.69
192 0.63
193 0.62