Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5TKH1

Protein Details
Accession A0A1Z5TKH1   
Localization Confidence Low
Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-86RLTQPFRQGQRRRLPRCRNWIRRWRAVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 24, nucl 1, mito 1, cyto 1, cyto_nucl 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR011013  Gal_mutarotase_sf_dom  
IPR014718  GH-type_carb-bd  
Gene Ontology GO:0030246  F:carbohydrate binding  
GO:0003824  F:catalytic activity  
GO:0005975  P:carbohydrate metabolic process  
Amino Acid Sequences MSLLRGALLLACSTAALAHNGHGNHGHDDSPFPPFSGNPFEKVHLSAKGINASFIPYGARLTQPFRQGQRRRLPRCRNWIRRWRAVLERHIDRPHFLRCHPLAAMPTASRIVPFEIDGETSNIVANEHDGLNTLHGGEIGYEPGKLGYDVVIQNYVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.08
4 0.08
5 0.09
6 0.13
7 0.13
8 0.15
9 0.17
10 0.19
11 0.2
12 0.21
13 0.21
14 0.17
15 0.19
16 0.19
17 0.2
18 0.18
19 0.15
20 0.15
21 0.14
22 0.17
23 0.24
24 0.25
25 0.24
26 0.26
27 0.27
28 0.28
29 0.31
30 0.3
31 0.23
32 0.24
33 0.23
34 0.23
35 0.26
36 0.24
37 0.22
38 0.19
39 0.18
40 0.16
41 0.13
42 0.12
43 0.07
44 0.08
45 0.09
46 0.1
47 0.1
48 0.14
49 0.18
50 0.22
51 0.26
52 0.3
53 0.4
54 0.45
55 0.52
56 0.59
57 0.65
58 0.69
59 0.76
60 0.8
61 0.78
62 0.83
63 0.85
64 0.85
65 0.84
66 0.85
67 0.82
68 0.8
69 0.75
70 0.68
71 0.64
72 0.6
73 0.57
74 0.53
75 0.49
76 0.47
77 0.46
78 0.42
79 0.36
80 0.34
81 0.34
82 0.3
83 0.27
84 0.3
85 0.28
86 0.31
87 0.29
88 0.28
89 0.22
90 0.22
91 0.23
92 0.15
93 0.16
94 0.14
95 0.13
96 0.11
97 0.11
98 0.11
99 0.09
100 0.1
101 0.09
102 0.09
103 0.1
104 0.11
105 0.11
106 0.1
107 0.1
108 0.1
109 0.09
110 0.09
111 0.08
112 0.08
113 0.08
114 0.08
115 0.07
116 0.09
117 0.09
118 0.1
119 0.1
120 0.09
121 0.07
122 0.07
123 0.08
124 0.07
125 0.07
126 0.09
127 0.09
128 0.09
129 0.09
130 0.09
131 0.1
132 0.09
133 0.09
134 0.08
135 0.12
136 0.14
137 0.16