Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H8Z992

Protein Details
Accession H8Z992    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-50IYERICSKKSFLKKNKNSLKRLRRKERRKQRKYRKIEYMKVWRMNNHydrophilic
NLS Segment(s)
PositionSequence
13-39KSFLKKNKNSLKRLRRKERRKQRKYRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.333, mito_nucl 13.166
Family & Domain DBs
Amino Acid Sequences MLSRIYERICSKKSFLKKNKNSLKRLRRKERRKQRKYRKIEYMKVWRMNNSFQISVKDAPCNRVFNRFYNQFIIYWPDALHNQYYDALEKEVLSHVIPTKNGYVDCALLQTPFNMPSPVDYYASYGSHRLIEEEDVECESGEKEENSDEWRQSTPMIIDSQEMLGQLRSDYMYSDLSLETISEQKSEMSLMSELMTALSSSEEKGGTLENEPMEESPLTDTLKEIEAGKEKATVCNILSLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.72
4 0.77
5 0.84
6 0.9
7 0.91
8 0.91
9 0.91
10 0.91
11 0.91
12 0.92
13 0.92
14 0.93
15 0.94
16 0.95
17 0.95
18 0.96
19 0.96
20 0.96
21 0.96
22 0.96
23 0.95
24 0.94
25 0.94
26 0.93
27 0.9
28 0.89
29 0.88
30 0.87
31 0.84
32 0.76
33 0.71
34 0.64
35 0.6
36 0.57
37 0.5
38 0.43
39 0.37
40 0.38
41 0.35
42 0.36
43 0.34
44 0.33
45 0.31
46 0.34
47 0.36
48 0.38
49 0.36
50 0.41
51 0.42
52 0.39
53 0.46
54 0.45
55 0.44
56 0.42
57 0.42
58 0.33
59 0.31
60 0.32
61 0.24
62 0.21
63 0.18
64 0.16
65 0.16
66 0.17
67 0.16
68 0.11
69 0.12
70 0.12
71 0.13
72 0.12
73 0.12
74 0.11
75 0.1
76 0.1
77 0.1
78 0.09
79 0.09
80 0.08
81 0.08
82 0.11
83 0.12
84 0.12
85 0.13
86 0.14
87 0.15
88 0.15
89 0.14
90 0.12
91 0.11
92 0.11
93 0.1
94 0.09
95 0.08
96 0.08
97 0.08
98 0.08
99 0.09
100 0.09
101 0.08
102 0.08
103 0.09
104 0.12
105 0.13
106 0.13
107 0.12
108 0.13
109 0.14
110 0.15
111 0.14
112 0.11
113 0.1
114 0.11
115 0.1
116 0.09
117 0.09
118 0.09
119 0.1
120 0.1
121 0.1
122 0.09
123 0.09
124 0.08
125 0.07
126 0.07
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.07
133 0.1
134 0.13
135 0.13
136 0.14
137 0.15
138 0.14
139 0.14
140 0.15
141 0.12
142 0.12
143 0.12
144 0.11
145 0.11
146 0.11
147 0.11
148 0.1
149 0.1
150 0.08
151 0.07
152 0.07
153 0.06
154 0.07
155 0.06
156 0.06
157 0.07
158 0.08
159 0.09
160 0.09
161 0.1
162 0.09
163 0.09
164 0.08
165 0.08
166 0.07
167 0.09
168 0.1
169 0.09
170 0.09
171 0.09
172 0.1
173 0.1
174 0.09
175 0.09
176 0.09
177 0.09
178 0.09
179 0.09
180 0.09
181 0.08
182 0.08
183 0.06
184 0.06
185 0.06
186 0.06
187 0.07
188 0.08
189 0.08
190 0.08
191 0.09
192 0.1
193 0.11
194 0.12
195 0.15
196 0.14
197 0.14
198 0.15
199 0.15
200 0.16
201 0.14
202 0.13
203 0.12
204 0.15
205 0.15
206 0.14
207 0.14
208 0.14
209 0.15
210 0.16
211 0.15
212 0.17
213 0.23
214 0.24
215 0.25
216 0.28
217 0.28
218 0.31
219 0.32
220 0.3
221 0.24
222 0.28