Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5T1F9

Protein Details
Accession A0A1Z5T1F9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-76KAIVTGKKPQSRRRARSEEPKEEBasic
NLS Segment(s)
PositionSequence
60-69KKPQSRRRAR
Subcellular Location(s) cyto 7.5cyto_nucl 7.5, nucl 6.5, mito 5, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTDQAPTQQSKADKFMRGAGEVRDTNLWGPAKWVVQLVQYMVAIIMITIGEGFKAIVTGKKPQSRRRARSEEPKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.39
4 0.37
5 0.35
6 0.3
7 0.3
8 0.27
9 0.27
10 0.22
11 0.2
12 0.18
13 0.21
14 0.19
15 0.13
16 0.15
17 0.15
18 0.15
19 0.14
20 0.15
21 0.1
22 0.11
23 0.11
24 0.1
25 0.09
26 0.08
27 0.07
28 0.06
29 0.06
30 0.04
31 0.04
32 0.03
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.03
40 0.02
41 0.03
42 0.04
43 0.08
44 0.1
45 0.18
46 0.26
47 0.34
48 0.42
49 0.5
50 0.61
51 0.69
52 0.75
53 0.78
54 0.8
55 0.82
56 0.86