Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Z5SXG1

Protein Details
Accession A0A1Z5SXG1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-40EIDPKRRAYVRHKIRPSNNQRKSKKKGSESEYHydrophilic
NLS Segment(s)
PositionSequence
13-35KRRAYVRHKIRPSNNQRKSKKKG
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MGQKYSSVEIDPKRRAYVRHKIRPSNNQRKSKKKGSESEYTPVGGLPNLSRRRNSDSDDSVRSSSIDSPGPAAGGPGSGGWQSQMMQRAMGPPGGIGGGGGGGDGGSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.55
4 0.58
5 0.6
6 0.65
7 0.71
8 0.75
9 0.8
10 0.85
11 0.87
12 0.88
13 0.86
14 0.86
15 0.86
16 0.87
17 0.87
18 0.86
19 0.84
20 0.82
21 0.81
22 0.76
23 0.76
24 0.7
25 0.66
26 0.57
27 0.48
28 0.39
29 0.3
30 0.24
31 0.15
32 0.11
33 0.08
34 0.15
35 0.21
36 0.23
37 0.24
38 0.27
39 0.34
40 0.37
41 0.39
42 0.36
43 0.35
44 0.38
45 0.39
46 0.38
47 0.32
48 0.29
49 0.25
50 0.21
51 0.16
52 0.14
53 0.13
54 0.11
55 0.11
56 0.11
57 0.11
58 0.1
59 0.09
60 0.06
61 0.05
62 0.05
63 0.04
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.07
70 0.1
71 0.15
72 0.15
73 0.15
74 0.16
75 0.19
76 0.19
77 0.19
78 0.16
79 0.1
80 0.11
81 0.1
82 0.09
83 0.06
84 0.05
85 0.04
86 0.04
87 0.04
88 0.03