Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Z5T2N1

Protein Details
Accession A0A1Z5T2N1    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
199-223ANRPAKTPLRRKEKHAKRNTDNMEDHydrophilic
NLS Segment(s)
PositionSequence
201-216RPAKTPLRRKEKHAKR
Subcellular Location(s) cyto_nucl 11.5, cyto 11, nucl 10, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008721  ORC6  
Gene Ontology GO:0005664  C:nuclear origin of replication recognition complex  
GO:0003677  F:DNA binding  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF05460  ORC6  
Amino Acid Sequences MPSPVELALISLLPTTSPIPSELIELSNSLVAQSRSRASSMKPEEEIGRTYTCCHIACERLGKKLSLELGKPSPPVKPALYKKLKTYLSSALRTPAATPRRATRTEDKVGSAVGTPTGEKSSAAATPSSVGRRGLRSADATPKQSAQATTPTSGRKRKVDEVDESATRTATDLPGFPEDPTADAGGGDDAEVGKELIPANRPAKTPLRRKEKHAKRNTDNMEDLGPAGLLPGLGTMFQPALDWLGDERHAEYIAWKKDMMAEIAAIERGQAVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.1
5 0.11
6 0.12
7 0.13
8 0.15
9 0.15
10 0.15
11 0.15
12 0.14
13 0.14
14 0.13
15 0.12
16 0.1
17 0.12
18 0.12
19 0.13
20 0.16
21 0.18
22 0.19
23 0.21
24 0.23
25 0.22
26 0.31
27 0.37
28 0.38
29 0.37
30 0.38
31 0.39
32 0.39
33 0.39
34 0.31
35 0.27
36 0.22
37 0.23
38 0.23
39 0.24
40 0.22
41 0.23
42 0.24
43 0.25
44 0.28
45 0.36
46 0.36
47 0.38
48 0.4
49 0.37
50 0.35
51 0.35
52 0.36
53 0.3
54 0.29
55 0.28
56 0.3
57 0.31
58 0.33
59 0.3
60 0.27
61 0.24
62 0.27
63 0.24
64 0.3
65 0.35
66 0.43
67 0.52
68 0.52
69 0.54
70 0.59
71 0.59
72 0.51
73 0.49
74 0.47
75 0.44
76 0.44
77 0.41
78 0.35
79 0.33
80 0.31
81 0.28
82 0.27
83 0.25
84 0.26
85 0.27
86 0.3
87 0.35
88 0.37
89 0.41
90 0.41
91 0.45
92 0.47
93 0.47
94 0.42
95 0.36
96 0.34
97 0.29
98 0.21
99 0.14
100 0.09
101 0.07
102 0.06
103 0.07
104 0.07
105 0.07
106 0.06
107 0.07
108 0.08
109 0.08
110 0.09
111 0.08
112 0.08
113 0.09
114 0.1
115 0.11
116 0.11
117 0.11
118 0.12
119 0.14
120 0.15
121 0.15
122 0.15
123 0.16
124 0.18
125 0.24
126 0.25
127 0.26
128 0.25
129 0.25
130 0.24
131 0.23
132 0.21
133 0.15
134 0.18
135 0.17
136 0.18
137 0.2
138 0.24
139 0.29
140 0.34
141 0.37
142 0.36
143 0.4
144 0.46
145 0.5
146 0.5
147 0.48
148 0.48
149 0.48
150 0.43
151 0.39
152 0.32
153 0.25
154 0.2
155 0.16
156 0.11
157 0.08
158 0.09
159 0.08
160 0.1
161 0.13
162 0.13
163 0.13
164 0.14
165 0.13
166 0.13
167 0.13
168 0.11
169 0.09
170 0.08
171 0.08
172 0.06
173 0.06
174 0.05
175 0.04
176 0.03
177 0.04
178 0.04
179 0.04
180 0.04
181 0.05
182 0.07
183 0.08
184 0.11
185 0.17
186 0.19
187 0.22
188 0.23
189 0.27
190 0.36
191 0.43
192 0.51
193 0.55
194 0.63
195 0.64
196 0.71
197 0.78
198 0.79
199 0.81
200 0.81
201 0.82
202 0.78
203 0.86
204 0.84
205 0.79
206 0.7
207 0.61
208 0.51
209 0.41
210 0.34
211 0.24
212 0.17
213 0.1
214 0.08
215 0.06
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.05
222 0.06
223 0.06
224 0.06
225 0.06
226 0.06
227 0.08
228 0.07
229 0.08
230 0.08
231 0.1
232 0.12
233 0.13
234 0.13
235 0.13
236 0.14
237 0.13
238 0.17
239 0.24
240 0.28
241 0.29
242 0.27
243 0.26
244 0.31
245 0.33
246 0.3
247 0.22
248 0.18
249 0.17
250 0.18
251 0.19
252 0.13
253 0.11