Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5SQE5

Protein Details
Accession A0A1Z5SQE5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
223-248MYKERPHLSRDEKRRRKELSHRLMYVBasic
NLS Segment(s)
PositionSequence
235-238KRRR
Subcellular Location(s) nucl 16, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038883  AN11006-like  
Amino Acid Sequences MATPQPLTTDQQSPLFSKLSAEIRNRIYHYALREDEGIDISHFRQPPLTRVCRQVRGECLSMFYFINEFRYRTRSSGSGAFEWLLRVLAMMGRNRHRYIKDLWIEIDVDNGLMLGGLYEDSNPWTRLFRELGRLRCYPTIRVASNHDEYCGWFAHHAISDDPFHIKLVQTYRSWLDGSLQAYFYELEERYWEVDEDGNQLISRHVTSIETESRRTAFLVDHLMYKERPHLSRDEKRRRKELSHRLMYVALELLHEEQEQEAEAEKMRAEVADAEEAARGESPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.28
4 0.24
5 0.27
6 0.29
7 0.33
8 0.36
9 0.39
10 0.42
11 0.48
12 0.49
13 0.46
14 0.43
15 0.4
16 0.39
17 0.41
18 0.37
19 0.34
20 0.32
21 0.3
22 0.28
23 0.25
24 0.21
25 0.14
26 0.14
27 0.14
28 0.18
29 0.18
30 0.17
31 0.22
32 0.23
33 0.31
34 0.38
35 0.44
36 0.43
37 0.52
38 0.59
39 0.61
40 0.65
41 0.63
42 0.61
43 0.58
44 0.57
45 0.48
46 0.44
47 0.36
48 0.32
49 0.27
50 0.2
51 0.16
52 0.13
53 0.19
54 0.17
55 0.18
56 0.19
57 0.24
58 0.25
59 0.26
60 0.28
61 0.25
62 0.26
63 0.31
64 0.32
65 0.28
66 0.27
67 0.25
68 0.22
69 0.21
70 0.17
71 0.11
72 0.07
73 0.06
74 0.05
75 0.07
76 0.1
77 0.13
78 0.18
79 0.23
80 0.28
81 0.3
82 0.35
83 0.34
84 0.34
85 0.36
86 0.4
87 0.38
88 0.36
89 0.34
90 0.31
91 0.31
92 0.26
93 0.23
94 0.13
95 0.09
96 0.07
97 0.06
98 0.04
99 0.03
100 0.03
101 0.02
102 0.02
103 0.02
104 0.03
105 0.03
106 0.03
107 0.05
108 0.07
109 0.08
110 0.09
111 0.1
112 0.11
113 0.14
114 0.16
115 0.16
116 0.24
117 0.29
118 0.33
119 0.37
120 0.37
121 0.37
122 0.39
123 0.39
124 0.31
125 0.3
126 0.3
127 0.26
128 0.27
129 0.29
130 0.29
131 0.31
132 0.3
133 0.25
134 0.21
135 0.2
136 0.2
137 0.16
138 0.11
139 0.07
140 0.08
141 0.08
142 0.09
143 0.1
144 0.08
145 0.09
146 0.1
147 0.11
148 0.12
149 0.1
150 0.1
151 0.1
152 0.09
153 0.11
154 0.14
155 0.17
156 0.16
157 0.19
158 0.2
159 0.21
160 0.21
161 0.17
162 0.16
163 0.15
164 0.16
165 0.15
166 0.14
167 0.12
168 0.13
169 0.13
170 0.11
171 0.11
172 0.1
173 0.09
174 0.1
175 0.11
176 0.11
177 0.12
178 0.12
179 0.09
180 0.1
181 0.11
182 0.12
183 0.12
184 0.11
185 0.1
186 0.11
187 0.1
188 0.1
189 0.1
190 0.08
191 0.08
192 0.08
193 0.1
194 0.14
195 0.21
196 0.22
197 0.23
198 0.25
199 0.25
200 0.25
201 0.24
202 0.2
203 0.14
204 0.14
205 0.19
206 0.18
207 0.2
208 0.2
209 0.23
210 0.22
211 0.22
212 0.27
213 0.26
214 0.27
215 0.27
216 0.35
217 0.42
218 0.52
219 0.62
220 0.66
221 0.71
222 0.77
223 0.83
224 0.81
225 0.81
226 0.82
227 0.82
228 0.82
229 0.81
230 0.75
231 0.68
232 0.63
233 0.54
234 0.44
235 0.34
236 0.23
237 0.14
238 0.13
239 0.12
240 0.11
241 0.11
242 0.1
243 0.09
244 0.09
245 0.09
246 0.09
247 0.09
248 0.09
249 0.1
250 0.11
251 0.1
252 0.11
253 0.1
254 0.1
255 0.1
256 0.11
257 0.13
258 0.15
259 0.15
260 0.15
261 0.16
262 0.16
263 0.16