Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H0EJT1

Protein Details
Accession H0EJT1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
41-64SDSMRQLKKTKSHRKHGRFRGEVVBasic
NLS Segment(s)
PositionSequence
48-58KKTKSHRKHGR
Subcellular Location(s) cyto 9.5, cyto_mito 9.166, cyto_nucl 8.833, mito 7.5, nucl 6
Family & Domain DBs
Amino Acid Sequences MSSKQILIPGSLLGGPNLPISQTFEVEYQRVQASRNAVVNSDSMRQLKKTKSHRKHGRFRGEVVPRNRCFFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.08
6 0.07
7 0.12
8 0.13
9 0.13
10 0.14
11 0.15
12 0.16
13 0.16
14 0.16
15 0.13
16 0.13
17 0.13
18 0.13
19 0.13
20 0.15
21 0.17
22 0.19
23 0.17
24 0.17
25 0.17
26 0.17
27 0.16
28 0.15
29 0.15
30 0.14
31 0.15
32 0.17
33 0.22
34 0.27
35 0.34
36 0.44
37 0.53
38 0.6
39 0.71
40 0.79
41 0.84
42 0.89
43 0.91
44 0.91
45 0.84
46 0.79
47 0.78
48 0.77
49 0.75
50 0.73
51 0.73
52 0.65