Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Z5TIU7

Protein Details
Accession A0A1Z5TIU7    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
29-50SDSWLLRERKKKSKRTCICWTFHydrophilic
NLS Segment(s)
PositionSequence
37-41RKKKS
Subcellular Location(s) plas 11, mito 7.5, cyto_mito 6, cyto 3.5, nucl 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAVPRDPAFWKRFSMAVHMDEEKGAPEYSDSWLLRERKKKSKRTCICWTFWIIFFIFIAAIVAIIIWLLKSGVLDNVGGTGSSLDPDTAAES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.3
4 0.32
5 0.3
6 0.28
7 0.25
8 0.24
9 0.19
10 0.16
11 0.13
12 0.09
13 0.08
14 0.09
15 0.11
16 0.17
17 0.16
18 0.16
19 0.22
20 0.27
21 0.33
22 0.4
23 0.45
24 0.49
25 0.59
26 0.67
27 0.72
28 0.79
29 0.8
30 0.81
31 0.84
32 0.79
33 0.72
34 0.65
35 0.58
36 0.49
37 0.41
38 0.34
39 0.23
40 0.18
41 0.15
42 0.12
43 0.08
44 0.06
45 0.05
46 0.03
47 0.03
48 0.03
49 0.03
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.03
57 0.03
58 0.04
59 0.05
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.06
69 0.07
70 0.07
71 0.06
72 0.06