Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5SPW0

Protein Details
Accession A0A1Z5SPW0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
54-79KHPWASRKAARRALRRRRLAKANVKSHydrophilic
NLS Segment(s)
PositionSequence
52-75KVKHPWASRKAARRALRRRRLAKA
Subcellular Location(s) plas 8, nucl 6, mito 5, pero 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MGKTYGYQMIDLHPDHADDTGPSPGAGQHAIDCDALGLYTDSDEEAAVTPPKVKHPWASRKAARRALRRRRLAKANVKSMVKLGMLGMPAVLLMFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.14
5 0.1
6 0.11
7 0.11
8 0.11
9 0.1
10 0.1
11 0.1
12 0.11
13 0.11
14 0.09
15 0.08
16 0.09
17 0.11
18 0.1
19 0.09
20 0.08
21 0.07
22 0.07
23 0.06
24 0.05
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.06
35 0.06
36 0.08
37 0.09
38 0.12
39 0.14
40 0.15
41 0.21
42 0.31
43 0.41
44 0.46
45 0.54
46 0.57
47 0.64
48 0.71
49 0.73
50 0.72
51 0.72
52 0.76
53 0.78
54 0.82
55 0.83
56 0.81
57 0.81
58 0.82
59 0.82
60 0.81
61 0.79
62 0.78
63 0.75
64 0.7
65 0.62
66 0.54
67 0.47
68 0.36
69 0.28
70 0.2
71 0.15
72 0.14
73 0.13
74 0.11
75 0.08
76 0.08