Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5TTT1

Protein Details
Accession A0A1Z5TTT1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
287-307GPFRQRWQELKERARRKRMLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8, cyto 6, cysk 6, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002123  Plipid/glycerol_acylTrfase  
IPR000872  Tafazzin  
Gene Ontology GO:0016746  F:acyltransferase activity  
GO:0006644  P:phospholipid metabolic process  
Pfam View protein in Pfam  
PF01553  Acyltransferase  
CDD cd07989  LPLAT_AGPAT-like  
Amino Acid Sequences MATEERPYKPSLPWRITSAIEIGVVGFLSRSFLYALNRTETYGIDNLLEILDRRSDESKRTRGLITVSNHTTAYRLDDPLMWGVLPYRYHWDPNNMRWALGSYDICFKNKMFEAFFSYGNTLPTHRKAYSQYGGIFQPTINQAIRLLSDPHANLAPEKSSRPADPPTLPTSLPPSDPFSAAQLTYSTNGADAFPSPSAYPFRRYGWVHIFPEGMIHQHPDKVMRYFKWGVARLILEAEPCPDVLPMWIDGPQQVMDNNRGWPRPLPRIGKDVSVAFGSPVDTEQVFGPFRQRWQELKERARRKRMLSYPTKDPAEDPEKEVLGELNDEELKYGQEAEQLRIEVTLAVRNEVLKVRRSRGLPDEDPKRGLAETFAAERGNPSRNGRRMGDGSVVQIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.55
3 0.54
4 0.49
5 0.41
6 0.32
7 0.25
8 0.22
9 0.16
10 0.12
11 0.11
12 0.08
13 0.06
14 0.05
15 0.07
16 0.07
17 0.08
18 0.09
19 0.12
20 0.16
21 0.22
22 0.25
23 0.28
24 0.28
25 0.29
26 0.29
27 0.26
28 0.26
29 0.22
30 0.2
31 0.15
32 0.14
33 0.14
34 0.13
35 0.13
36 0.09
37 0.09
38 0.11
39 0.11
40 0.14
41 0.18
42 0.21
43 0.29
44 0.37
45 0.43
46 0.45
47 0.48
48 0.46
49 0.44
50 0.45
51 0.44
52 0.4
53 0.4
54 0.39
55 0.37
56 0.36
57 0.33
58 0.31
59 0.24
60 0.26
61 0.21
62 0.19
63 0.19
64 0.2
65 0.21
66 0.22
67 0.22
68 0.14
69 0.12
70 0.12
71 0.14
72 0.14
73 0.14
74 0.18
75 0.2
76 0.24
77 0.26
78 0.35
79 0.38
80 0.43
81 0.51
82 0.45
83 0.43
84 0.4
85 0.39
86 0.31
87 0.29
88 0.24
89 0.15
90 0.23
91 0.24
92 0.25
93 0.25
94 0.23
95 0.24
96 0.26
97 0.28
98 0.21
99 0.22
100 0.28
101 0.28
102 0.29
103 0.25
104 0.24
105 0.22
106 0.22
107 0.21
108 0.16
109 0.19
110 0.22
111 0.25
112 0.24
113 0.27
114 0.29
115 0.36
116 0.37
117 0.37
118 0.34
119 0.32
120 0.32
121 0.29
122 0.26
123 0.18
124 0.17
125 0.14
126 0.16
127 0.13
128 0.13
129 0.12
130 0.13
131 0.14
132 0.12
133 0.13
134 0.11
135 0.14
136 0.14
137 0.15
138 0.15
139 0.14
140 0.14
141 0.12
142 0.14
143 0.12
144 0.13
145 0.15
146 0.16
147 0.17
148 0.2
149 0.22
150 0.24
151 0.25
152 0.28
153 0.29
154 0.29
155 0.28
156 0.24
157 0.26
158 0.23
159 0.22
160 0.19
161 0.2
162 0.19
163 0.2
164 0.2
165 0.16
166 0.16
167 0.15
168 0.14
169 0.1
170 0.1
171 0.1
172 0.09
173 0.08
174 0.07
175 0.07
176 0.07
177 0.06
178 0.06
179 0.07
180 0.06
181 0.07
182 0.07
183 0.08
184 0.12
185 0.13
186 0.16
187 0.17
188 0.19
189 0.24
190 0.25
191 0.29
192 0.33
193 0.38
194 0.35
195 0.34
196 0.32
197 0.26
198 0.26
199 0.21
200 0.15
201 0.09
202 0.09
203 0.09
204 0.1
205 0.11
206 0.12
207 0.14
208 0.17
209 0.21
210 0.2
211 0.26
212 0.27
213 0.29
214 0.34
215 0.34
216 0.31
217 0.29
218 0.29
219 0.22
220 0.22
221 0.19
222 0.12
223 0.1
224 0.1
225 0.08
226 0.08
227 0.08
228 0.06
229 0.06
230 0.06
231 0.07
232 0.07
233 0.07
234 0.09
235 0.09
236 0.09
237 0.1
238 0.1
239 0.09
240 0.1
241 0.11
242 0.13
243 0.14
244 0.19
245 0.21
246 0.21
247 0.22
248 0.26
249 0.3
250 0.35
251 0.41
252 0.44
253 0.43
254 0.49
255 0.49
256 0.46
257 0.42
258 0.34
259 0.27
260 0.21
261 0.18
262 0.13
263 0.12
264 0.1
265 0.08
266 0.08
267 0.08
268 0.07
269 0.08
270 0.08
271 0.11
272 0.11
273 0.12
274 0.17
275 0.17
276 0.2
277 0.25
278 0.29
279 0.3
280 0.36
281 0.45
282 0.5
283 0.58
284 0.65
285 0.7
286 0.75
287 0.81
288 0.81
289 0.77
290 0.78
291 0.76
292 0.76
293 0.76
294 0.73
295 0.72
296 0.73
297 0.68
298 0.58
299 0.51
300 0.49
301 0.45
302 0.41
303 0.36
304 0.32
305 0.31
306 0.3
307 0.29
308 0.22
309 0.16
310 0.15
311 0.12
312 0.11
313 0.11
314 0.11
315 0.11
316 0.11
317 0.11
318 0.1
319 0.11
320 0.08
321 0.13
322 0.15
323 0.17
324 0.2
325 0.2
326 0.2
327 0.19
328 0.19
329 0.15
330 0.14
331 0.17
332 0.14
333 0.15
334 0.15
335 0.16
336 0.18
337 0.22
338 0.25
339 0.28
340 0.34
341 0.38
342 0.43
343 0.45
344 0.49
345 0.51
346 0.57
347 0.56
348 0.59
349 0.63
350 0.62
351 0.62
352 0.56
353 0.5
354 0.41
355 0.34
356 0.27
357 0.21
358 0.2
359 0.2
360 0.21
361 0.2
362 0.19
363 0.22
364 0.25
365 0.27
366 0.29
367 0.34
368 0.42
369 0.49
370 0.55
371 0.54
372 0.57
373 0.55
374 0.54
375 0.52
376 0.43