Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Z5THN4

Protein Details
Accession A0A1Z5THN4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-76VTGEKPQGRRRARSEERKEEBasic
NLS Segment(s)
PositionSequence
64-72GRRRARSEE
Subcellular Location(s) nucl 7, cyto 6, mito_nucl 6, mito 5, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MADQPPTQQSKADKFMRGAGEVRDTNLWGPAKWVVQLVQYMIAIIMITIGEGFKAIVTGEKPQGRRRARSEERKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.46
4 0.42
5 0.37
6 0.3
7 0.3
8 0.27
9 0.27
10 0.22
11 0.2
12 0.18
13 0.21
14 0.19
15 0.13
16 0.15
17 0.15
18 0.15
19 0.14
20 0.15
21 0.1
22 0.11
23 0.11
24 0.1
25 0.09
26 0.08
27 0.07
28 0.06
29 0.06
30 0.04
31 0.04
32 0.03
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.03
40 0.02
41 0.03
42 0.03
43 0.05
44 0.07
45 0.11
46 0.18
47 0.23
48 0.27
49 0.34
50 0.44
51 0.49
52 0.56
53 0.6
54 0.64
55 0.7
56 0.77