Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0ELH2

Protein Details
Accession H0ELH2    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
8-27GAKIRRLKLQTKNTNKGFYKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, mito_nucl 12.333, cyto_nucl 5.166, nucl 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019189  Ribosomal_L27/L41_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF09809  MRP-L27  
Amino Acid Sequences MRATQSLGAKIRRLKLQTKNTNKGFYKGTGTGSTGSHTKHGGYLIDWDKLKPFVTMKIQPTRGYFEGDPKGAFSGKLYLEKWKKENGED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.64
4 0.69
5 0.73
6 0.78
7 0.76
8 0.8
9 0.73
10 0.66
11 0.58
12 0.5
13 0.45
14 0.37
15 0.35
16 0.27
17 0.27
18 0.25
19 0.22
20 0.21
21 0.17
22 0.16
23 0.14
24 0.13
25 0.12
26 0.12
27 0.12
28 0.11
29 0.09
30 0.15
31 0.15
32 0.18
33 0.18
34 0.17
35 0.17
36 0.18
37 0.18
38 0.13
39 0.12
40 0.14
41 0.2
42 0.26
43 0.31
44 0.38
45 0.41
46 0.42
47 0.43
48 0.44
49 0.39
50 0.38
51 0.33
52 0.32
53 0.34
54 0.32
55 0.31
56 0.25
57 0.26
58 0.21
59 0.21
60 0.15
61 0.16
62 0.17
63 0.22
64 0.22
65 0.31
66 0.38
67 0.45
68 0.47
69 0.5