Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5TPH8

Protein Details
Accession A0A1Z5TPH8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
179-199GSKEIPKDKKSKDTKYVDERPBasic
NLS Segment(s)
Subcellular Location(s) mito 13, extr 9, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038330  TspO/MBR-related_sf  
IPR004307  TspO_MBR  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF03073  TspO_MBR  
CDD cd15904  TSPO_MBR  
Amino Acid Sequences MTTYIHSLTLPSITFEHPAAAILLPIAAGTAVGFSTRPKETQRTYLALRQPPLRPPPQVFGPVWTLLYGLMGYAAYRAWNVGVGSFDAKKVLLAKQGATLYTVQLGLNLIWMPLFFRFKRPIEATVDLAALVGVTGYLTYIWGQVDEVAGWCLAPYMAWLGFATYLSAGAGYLNNWDFGSKEIPKDKKSKDTKYVDERP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.14
5 0.14
6 0.13
7 0.11
8 0.09
9 0.07
10 0.07
11 0.05
12 0.05
13 0.04
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.04
20 0.04
21 0.05
22 0.1
23 0.12
24 0.15
25 0.19
26 0.26
27 0.3
28 0.38
29 0.42
30 0.43
31 0.46
32 0.5
33 0.53
34 0.51
35 0.5
36 0.48
37 0.46
38 0.48
39 0.51
40 0.48
41 0.45
42 0.44
43 0.45
44 0.43
45 0.45
46 0.38
47 0.34
48 0.33
49 0.29
50 0.26
51 0.21
52 0.17
53 0.12
54 0.12
55 0.08
56 0.05
57 0.04
58 0.03
59 0.03
60 0.03
61 0.04
62 0.03
63 0.04
64 0.04
65 0.04
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.08
72 0.08
73 0.08
74 0.07
75 0.07
76 0.07
77 0.09
78 0.09
79 0.12
80 0.12
81 0.13
82 0.16
83 0.16
84 0.16
85 0.15
86 0.14
87 0.1
88 0.1
89 0.1
90 0.06
91 0.06
92 0.06
93 0.05
94 0.06
95 0.05
96 0.05
97 0.04
98 0.04
99 0.05
100 0.06
101 0.1
102 0.1
103 0.15
104 0.2
105 0.22
106 0.28
107 0.3
108 0.32
109 0.34
110 0.36
111 0.33
112 0.29
113 0.27
114 0.21
115 0.18
116 0.14
117 0.08
118 0.05
119 0.03
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.03
126 0.03
127 0.04
128 0.05
129 0.05
130 0.05
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.05
138 0.05
139 0.05
140 0.04
141 0.04
142 0.04
143 0.06
144 0.06
145 0.07
146 0.07
147 0.08
148 0.08
149 0.09
150 0.09
151 0.06
152 0.06
153 0.05
154 0.06
155 0.05
156 0.05
157 0.05
158 0.05
159 0.09
160 0.09
161 0.1
162 0.1
163 0.11
164 0.11
165 0.13
166 0.19
167 0.18
168 0.25
169 0.33
170 0.4
171 0.46
172 0.55
173 0.59
174 0.63
175 0.7
176 0.73
177 0.75
178 0.77
179 0.8