Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Z5TMW8

Protein Details
Accession A0A1Z5TMW8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
548-587RDRARDRDRDRDRDYRRDSRRYDDRRYDERYERRDRRDEEBasic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR043198  Cyclin/Ssn8  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Amino Acid Sequences MERLNAGEVQRPSPPEEESQASHVPEAANQPVTGTDVARNAMPPPRLPLAGKATPYNKRSPPPLPPPPPPPPDHNAKAGAAGPSAMAGTKRLSNGDSKPASAPAIGPHPSTIRVAAPYTTQASIEKALYPGAVDHHDRSLAEAKEDAYRLQGVTWIDSVRRSLQLPIKTFTTACCLYHKFRLQHPGADYAFADAAAASLLASCKIEDTLKKSRDILAAAYNLKLSAHDALGPDDVVFEAPSRVVIGIERLILESGGFDFRSVRKHEVLIKIAKAELKGFESGSNDVKKVADVGFTVLTDLHRTFAPMKHTTSTQAAACLEMAAHLEAAKSPSVTTIRDHLQKDLDYKKWETTRENVMEILLDLLDLYTHHTTSTILGTKYSLDDLLRIRLALNKECSDNAIPRYQTVPESAAAHPSVNGATLQVANGHPTPVSPPDPDAQLIGQPIVTGVPPVPEGGGTLRFVLNPKLAAEEKGEVQKFFTEEWEEYEEELEIPLPKPPKPAAPTRDYDRRSDYDRFSDVDDRDRGFPPPPRGFDNRRSRDDFRDRERDRARDRDRDRDRDYRRDSRRYDDRRYDERYERRDRRDEEYYRRSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.33
4 0.35
5 0.33
6 0.36
7 0.36
8 0.35
9 0.32
10 0.3
11 0.25
12 0.24
13 0.26
14 0.25
15 0.22
16 0.21
17 0.21
18 0.2
19 0.22
20 0.2
21 0.17
22 0.15
23 0.16
24 0.17
25 0.17
26 0.18
27 0.18
28 0.24
29 0.25
30 0.24
31 0.27
32 0.3
33 0.32
34 0.33
35 0.37
36 0.39
37 0.41
38 0.42
39 0.43
40 0.47
41 0.52
42 0.55
43 0.57
44 0.55
45 0.55
46 0.6
47 0.6
48 0.63
49 0.64
50 0.71
51 0.7
52 0.71
53 0.75
54 0.76
55 0.76
56 0.7
57 0.67
58 0.61
59 0.63
60 0.59
61 0.56
62 0.51
63 0.44
64 0.43
65 0.39
66 0.34
67 0.25
68 0.21
69 0.15
70 0.12
71 0.11
72 0.09
73 0.07
74 0.08
75 0.1
76 0.12
77 0.14
78 0.15
79 0.17
80 0.22
81 0.26
82 0.34
83 0.33
84 0.32
85 0.32
86 0.32
87 0.32
88 0.26
89 0.23
90 0.17
91 0.22
92 0.21
93 0.2
94 0.2
95 0.21
96 0.22
97 0.22
98 0.21
99 0.16
100 0.17
101 0.18
102 0.17
103 0.17
104 0.18
105 0.2
106 0.18
107 0.17
108 0.16
109 0.17
110 0.18
111 0.18
112 0.16
113 0.14
114 0.13
115 0.13
116 0.12
117 0.1
118 0.11
119 0.13
120 0.15
121 0.16
122 0.17
123 0.18
124 0.17
125 0.2
126 0.25
127 0.22
128 0.21
129 0.2
130 0.2
131 0.23
132 0.23
133 0.2
134 0.15
135 0.15
136 0.14
137 0.13
138 0.16
139 0.12
140 0.13
141 0.15
142 0.14
143 0.13
144 0.14
145 0.16
146 0.15
147 0.17
148 0.16
149 0.21
150 0.26
151 0.32
152 0.35
153 0.35
154 0.34
155 0.34
156 0.33
157 0.28
158 0.27
159 0.22
160 0.2
161 0.23
162 0.26
163 0.28
164 0.36
165 0.42
166 0.39
167 0.43
168 0.51
169 0.48
170 0.49
171 0.48
172 0.47
173 0.4
174 0.37
175 0.32
176 0.24
177 0.21
178 0.16
179 0.13
180 0.06
181 0.06
182 0.04
183 0.04
184 0.03
185 0.03
186 0.03
187 0.04
188 0.04
189 0.04
190 0.05
191 0.06
192 0.08
193 0.1
194 0.17
195 0.26
196 0.29
197 0.3
198 0.31
199 0.34
200 0.34
201 0.33
202 0.28
203 0.22
204 0.23
205 0.22
206 0.22
207 0.18
208 0.16
209 0.14
210 0.13
211 0.1
212 0.08
213 0.07
214 0.09
215 0.09
216 0.1
217 0.11
218 0.1
219 0.09
220 0.08
221 0.07
222 0.06
223 0.05
224 0.04
225 0.04
226 0.04
227 0.04
228 0.05
229 0.05
230 0.05
231 0.05
232 0.06
233 0.06
234 0.07
235 0.07
236 0.07
237 0.06
238 0.06
239 0.06
240 0.05
241 0.05
242 0.05
243 0.05
244 0.05
245 0.07
246 0.08
247 0.13
248 0.16
249 0.19
250 0.19
251 0.21
252 0.27
253 0.3
254 0.34
255 0.33
256 0.3
257 0.27
258 0.27
259 0.26
260 0.21
261 0.17
262 0.13
263 0.12
264 0.12
265 0.11
266 0.12
267 0.12
268 0.13
269 0.16
270 0.16
271 0.15
272 0.15
273 0.14
274 0.13
275 0.13
276 0.11
277 0.08
278 0.07
279 0.08
280 0.08
281 0.08
282 0.08
283 0.07
284 0.07
285 0.08
286 0.07
287 0.07
288 0.06
289 0.08
290 0.1
291 0.12
292 0.18
293 0.19
294 0.21
295 0.21
296 0.22
297 0.23
298 0.23
299 0.22
300 0.17
301 0.16
302 0.14
303 0.13
304 0.12
305 0.1
306 0.07
307 0.06
308 0.06
309 0.04
310 0.04
311 0.04
312 0.04
313 0.04
314 0.06
315 0.06
316 0.05
317 0.05
318 0.08
319 0.09
320 0.1
321 0.11
322 0.14
323 0.18
324 0.24
325 0.25
326 0.24
327 0.25
328 0.26
329 0.3
330 0.32
331 0.32
332 0.29
333 0.3
334 0.34
335 0.35
336 0.37
337 0.34
338 0.34
339 0.38
340 0.36
341 0.36
342 0.3
343 0.26
344 0.23
345 0.2
346 0.16
347 0.07
348 0.05
349 0.03
350 0.03
351 0.03
352 0.03
353 0.06
354 0.07
355 0.07
356 0.07
357 0.08
358 0.08
359 0.09
360 0.13
361 0.13
362 0.13
363 0.13
364 0.13
365 0.14
366 0.14
367 0.14
368 0.11
369 0.08
370 0.1
371 0.11
372 0.14
373 0.13
374 0.13
375 0.13
376 0.16
377 0.19
378 0.21
379 0.24
380 0.23
381 0.24
382 0.24
383 0.27
384 0.25
385 0.25
386 0.24
387 0.25
388 0.23
389 0.23
390 0.25
391 0.23
392 0.22
393 0.2
394 0.19
395 0.15
396 0.18
397 0.17
398 0.19
399 0.18
400 0.17
401 0.15
402 0.14
403 0.12
404 0.09
405 0.09
406 0.06
407 0.07
408 0.07
409 0.07
410 0.08
411 0.08
412 0.1
413 0.11
414 0.11
415 0.1
416 0.1
417 0.12
418 0.15
419 0.17
420 0.16
421 0.18
422 0.19
423 0.21
424 0.21
425 0.2
426 0.16
427 0.15
428 0.14
429 0.12
430 0.1
431 0.08
432 0.08
433 0.07
434 0.07
435 0.05
436 0.05
437 0.06
438 0.06
439 0.07
440 0.07
441 0.06
442 0.07
443 0.09
444 0.11
445 0.1
446 0.12
447 0.12
448 0.13
449 0.14
450 0.16
451 0.16
452 0.15
453 0.15
454 0.18
455 0.18
456 0.19
457 0.2
458 0.2
459 0.21
460 0.28
461 0.28
462 0.24
463 0.24
464 0.25
465 0.23
466 0.22
467 0.22
468 0.18
469 0.17
470 0.21
471 0.24
472 0.22
473 0.21
474 0.21
475 0.18
476 0.14
477 0.14
478 0.11
479 0.09
480 0.09
481 0.13
482 0.16
483 0.17
484 0.21
485 0.23
486 0.31
487 0.34
488 0.43
489 0.46
490 0.51
491 0.56
492 0.58
493 0.66
494 0.6
495 0.61
496 0.58
497 0.55
498 0.54
499 0.55
500 0.52
501 0.48
502 0.48
503 0.44
504 0.42
505 0.45
506 0.4
507 0.41
508 0.4
509 0.36
510 0.37
511 0.38
512 0.35
513 0.34
514 0.4
515 0.42
516 0.46
517 0.47
518 0.5
519 0.57
520 0.63
521 0.67
522 0.71
523 0.69
524 0.69
525 0.73
526 0.72
527 0.74
528 0.77
529 0.76
530 0.74
531 0.76
532 0.71
533 0.74
534 0.77
535 0.76
536 0.74
537 0.75
538 0.74
539 0.74
540 0.78
541 0.78
542 0.8
543 0.8
544 0.8
545 0.79
546 0.79
547 0.79
548 0.82
549 0.81
550 0.81
551 0.81
552 0.79
553 0.78
554 0.81
555 0.79
556 0.81
557 0.81
558 0.8
559 0.78
560 0.81
561 0.8
562 0.79
563 0.8
564 0.79
565 0.8
566 0.8
567 0.81
568 0.83
569 0.79
570 0.77
571 0.77
572 0.77
573 0.76
574 0.77