Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Z5SYE1

Protein Details
Accession A0A1Z5SYE1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
64-87ASQNQVSRHRRVRLQRKHSRPLSRHydrophilic
NLS Segment(s)
PositionSequence
73-84RRVRLQRKHSRP
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MEDAMQLVADSQLRPSHHHHVSLSRDKNIDSPAPALLLVNRRSARTTSILVVYDMAAAMRHAQASQNQVSRHRRVRLQRKHSRPLSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.25
3 0.32
4 0.34
5 0.37
6 0.37
7 0.4
8 0.48
9 0.54
10 0.52
11 0.47
12 0.45
13 0.42
14 0.43
15 0.38
16 0.32
17 0.23
18 0.2
19 0.17
20 0.16
21 0.15
22 0.13
23 0.11
24 0.15
25 0.15
26 0.2
27 0.2
28 0.2
29 0.22
30 0.22
31 0.23
32 0.2
33 0.2
34 0.16
35 0.17
36 0.17
37 0.16
38 0.15
39 0.13
40 0.1
41 0.08
42 0.06
43 0.05
44 0.04
45 0.05
46 0.05
47 0.05
48 0.06
49 0.08
50 0.11
51 0.16
52 0.21
53 0.25
54 0.27
55 0.35
56 0.42
57 0.49
58 0.54
59 0.55
60 0.59
61 0.65
62 0.74
63 0.76
64 0.8
65 0.83
66 0.84
67 0.89