Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Z5SYG1

Protein Details
Accession A0A1Z5SYG1    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
130-152ASCLFLKKDREMRRSRRRVSGSAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 4, nucl 2, extr 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR002018  CarbesteraseB  
Pfam View protein in Pfam  
PF00135  COesterase  
Amino Acid Sequences SAGGASVDIYSYAWPPRTHRHRASQQTPARVGIAGRGSGSDSSNFTYLAGLVGCGNLSASAELNCMRNVPAGELENTLSAYLVSDAEPSISFSPVVDDVLVFSDNAERAASGQVAQAPMIIGNNNNEGAASCLFLKKDREMRRSRRRVSGSAVEFLRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.23
3 0.34
4 0.42
5 0.51
6 0.56
7 0.63
8 0.69
9 0.78
10 0.8
11 0.79
12 0.77
13 0.75
14 0.7
15 0.61
16 0.51
17 0.41
18 0.34
19 0.28
20 0.24
21 0.17
22 0.15
23 0.13
24 0.14
25 0.14
26 0.15
27 0.12
28 0.11
29 0.13
30 0.13
31 0.13
32 0.12
33 0.11
34 0.1
35 0.09
36 0.07
37 0.06
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.03
44 0.04
45 0.04
46 0.04
47 0.05
48 0.06
49 0.07
50 0.08
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.11
60 0.11
61 0.11
62 0.1
63 0.1
64 0.08
65 0.07
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.05
75 0.07
76 0.07
77 0.07
78 0.07
79 0.06
80 0.08
81 0.08
82 0.08
83 0.06
84 0.05
85 0.05
86 0.07
87 0.07
88 0.05
89 0.05
90 0.07
91 0.07
92 0.08
93 0.07
94 0.06
95 0.06
96 0.08
97 0.08
98 0.07
99 0.08
100 0.09
101 0.09
102 0.09
103 0.09
104 0.08
105 0.08
106 0.08
107 0.07
108 0.07
109 0.09
110 0.11
111 0.11
112 0.1
113 0.1
114 0.1
115 0.12
116 0.11
117 0.1
118 0.09
119 0.11
120 0.12
121 0.16
122 0.2
123 0.25
124 0.34
125 0.43
126 0.52
127 0.6
128 0.7
129 0.78
130 0.85
131 0.84
132 0.85
133 0.82
134 0.77
135 0.75
136 0.74
137 0.67
138 0.63