Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5TDG1

Protein Details
Accession A0A1Z5TDG1   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
137-179LGSHRLRQPQQQRRKPQKRVRRPLAPRHPPRRLWRRPVMRAPPBasic
NLS Segment(s)
PositionSequence
147-179QQRRKPQKRVRRPLAPRHPPRRLWRRPVMRAPP
Subcellular Location(s) nucl 19, pero 4, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MANPNGGADDWEAEADQLAQQTQQMNMQQPPPQQGGPPGFSTFTPGAASFQPGAASFMPGQQFGQYGYGQQYGGFPQYGGGGYAQYGQYGGYGQGFPTPAANGTGPAPVKSLSIGAQETGAAPKVEKSAGGTKVMSLGSHRLRQPQQQRRKPQKRVRRPLAPRHPPRRLWRRPVMRAPPLAGAHRHGVWPFDPTPAERKAEARRADLVAQEQAQEVAEEDLEEMYGKEHVNVIFLGTSTPEVNSGCAILYATGMVDERTMDKYKKDAKTLAENLGISHGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.08
6 0.08
7 0.1
8 0.12
9 0.13
10 0.17
11 0.2
12 0.24
13 0.27
14 0.31
15 0.34
16 0.36
17 0.4
18 0.39
19 0.36
20 0.33
21 0.36
22 0.38
23 0.36
24 0.35
25 0.31
26 0.28
27 0.27
28 0.31
29 0.24
30 0.2
31 0.19
32 0.16
33 0.17
34 0.16
35 0.19
36 0.14
37 0.14
38 0.13
39 0.12
40 0.15
41 0.13
42 0.15
43 0.12
44 0.15
45 0.16
46 0.16
47 0.16
48 0.13
49 0.14
50 0.12
51 0.14
52 0.11
53 0.11
54 0.13
55 0.15
56 0.14
57 0.14
58 0.14
59 0.12
60 0.14
61 0.12
62 0.1
63 0.09
64 0.1
65 0.1
66 0.09
67 0.08
68 0.06
69 0.06
70 0.09
71 0.08
72 0.07
73 0.07
74 0.06
75 0.06
76 0.07
77 0.07
78 0.06
79 0.06
80 0.06
81 0.08
82 0.09
83 0.09
84 0.09
85 0.09
86 0.08
87 0.1
88 0.1
89 0.08
90 0.09
91 0.12
92 0.12
93 0.12
94 0.12
95 0.11
96 0.11
97 0.1
98 0.1
99 0.08
100 0.1
101 0.1
102 0.09
103 0.08
104 0.08
105 0.08
106 0.08
107 0.08
108 0.06
109 0.06
110 0.07
111 0.08
112 0.08
113 0.07
114 0.1
115 0.15
116 0.16
117 0.18
118 0.17
119 0.16
120 0.18
121 0.18
122 0.15
123 0.1
124 0.14
125 0.15
126 0.19
127 0.2
128 0.24
129 0.26
130 0.34
131 0.44
132 0.49
133 0.57
134 0.62
135 0.72
136 0.78
137 0.86
138 0.89
139 0.88
140 0.89
141 0.9
142 0.92
143 0.9
144 0.89
145 0.87
146 0.87
147 0.88
148 0.88
149 0.87
150 0.85
151 0.84
152 0.8
153 0.82
154 0.82
155 0.8
156 0.78
157 0.78
158 0.78
159 0.79
160 0.81
161 0.8
162 0.74
163 0.67
164 0.6
165 0.55
166 0.47
167 0.41
168 0.33
169 0.27
170 0.23
171 0.22
172 0.21
173 0.16
174 0.16
175 0.15
176 0.18
177 0.16
178 0.17
179 0.17
180 0.17
181 0.22
182 0.23
183 0.25
184 0.22
185 0.26
186 0.31
187 0.39
188 0.4
189 0.38
190 0.38
191 0.38
192 0.39
193 0.35
194 0.3
195 0.25
196 0.22
197 0.2
198 0.17
199 0.15
200 0.13
201 0.11
202 0.09
203 0.07
204 0.06
205 0.06
206 0.06
207 0.05
208 0.05
209 0.06
210 0.05
211 0.05
212 0.07
213 0.07
214 0.07
215 0.1
216 0.1
217 0.11
218 0.11
219 0.12
220 0.1
221 0.1
222 0.1
223 0.08
224 0.09
225 0.09
226 0.09
227 0.1
228 0.1
229 0.1
230 0.11
231 0.1
232 0.09
233 0.09
234 0.09
235 0.07
236 0.07
237 0.06
238 0.05
239 0.06
240 0.06
241 0.06
242 0.06
243 0.07
244 0.09
245 0.13
246 0.18
247 0.2
248 0.22
249 0.3
250 0.4
251 0.45
252 0.5
253 0.5
254 0.52
255 0.6
256 0.63
257 0.61
258 0.56
259 0.49
260 0.44