Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EFU9

Protein Details
Accession H0EFU9   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-57MFEKRARHKTREDRYEPKAKKSKQDKGQEKDTKRTTSRRLKKRDKNKPKKDGAELMRBasic
117-139ELAIAKSRQKEKRKTSKPVEDISHydrophilic
NLS Segment(s)
PositionSequence
4-50KRARHKTREDRYEPKAKKSKQDKGQEKDTKRTTSRRLKKRDKNKPKK
122-130KSRQKEKRK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MFEKRARHKTREDRYEPKAKKSKQDKGQEKDTKRTTSRRLKKRDKNKPKKDGAELMRNFSSKSIGQDRLTFRPSYGLGLFNNGRSSDPTTSGVPDLAFSEMDSLQQNEKRRHTTEKELAIAKSRQKEKRKTSKPVEDISAFFNQFRKPLHEINVENGQKRSRHIKSFATQEKSICVHQCVAPALFELRKLVRNEILTKSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.79
4 0.79
5 0.78
6 0.72
7 0.74
8 0.77
9 0.78
10 0.77
11 0.84
12 0.84
13 0.81
14 0.87
15 0.86
16 0.81
17 0.81
18 0.78
19 0.75
20 0.71
21 0.72
22 0.72
23 0.73
24 0.77
25 0.78
26 0.82
27 0.84
28 0.88
29 0.91
30 0.92
31 0.93
32 0.94
33 0.95
34 0.94
35 0.93
36 0.89
37 0.85
38 0.83
39 0.78
40 0.77
41 0.68
42 0.62
43 0.55
44 0.48
45 0.41
46 0.32
47 0.29
48 0.19
49 0.23
50 0.24
51 0.26
52 0.27
53 0.33
54 0.37
55 0.39
56 0.4
57 0.35
58 0.29
59 0.27
60 0.26
61 0.23
62 0.2
63 0.17
64 0.14
65 0.19
66 0.19
67 0.17
68 0.18
69 0.15
70 0.15
71 0.14
72 0.18
73 0.15
74 0.17
75 0.18
76 0.17
77 0.17
78 0.17
79 0.16
80 0.12
81 0.1
82 0.09
83 0.07
84 0.07
85 0.06
86 0.07
87 0.06
88 0.07
89 0.08
90 0.08
91 0.1
92 0.13
93 0.19
94 0.23
95 0.27
96 0.31
97 0.33
98 0.4
99 0.42
100 0.48
101 0.49
102 0.48
103 0.47
104 0.45
105 0.42
106 0.4
107 0.39
108 0.34
109 0.35
110 0.39
111 0.44
112 0.51
113 0.6
114 0.66
115 0.74
116 0.79
117 0.82
118 0.83
119 0.85
120 0.82
121 0.75
122 0.7
123 0.61
124 0.52
125 0.46
126 0.4
127 0.31
128 0.26
129 0.25
130 0.2
131 0.21
132 0.22
133 0.24
134 0.24
135 0.28
136 0.33
137 0.38
138 0.39
139 0.41
140 0.49
141 0.46
142 0.43
143 0.42
144 0.39
145 0.33
146 0.36
147 0.41
148 0.38
149 0.43
150 0.46
151 0.51
152 0.54
153 0.63
154 0.68
155 0.65
156 0.6
157 0.54
158 0.53
159 0.48
160 0.46
161 0.38
162 0.32
163 0.28
164 0.28
165 0.31
166 0.29
167 0.27
168 0.23
169 0.21
170 0.23
171 0.21
172 0.2
173 0.2
174 0.2
175 0.26
176 0.28
177 0.31
178 0.33
179 0.38
180 0.42