Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EKY4

Protein Details
Accession H0EKY4    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
172-201DDSSDSERDRKRQKKRKKTKAKGANAGNGIBasic
NLS Segment(s)
PositionSequence
180-196DRKRQKKRKKTKAKGAN
Subcellular Location(s) cyto 14, cyto_nucl 13.5, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR036322  WD40_repeat_dom_sf  
Amino Acid Sequences MEKEDELLCSVFVGGLPSRPGRSKGEKVLVGSAIGVLTLWERGVWDDQDERIIVDAGIGGGDSLDSLIAMPDGVGDGGKNVVVGVGDGTIRIVQLGPNKLVGEPLRHDEIESVVGLGFDVGGRLISGGGSIVKVWQEKMSLDDEDEEDSEEEEVAPKKRAADGSDSDEDSDDDSSDSERDRKRQKKRKKTKAKGANAGNGILKFKGLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.14
4 0.17
5 0.2
6 0.23
7 0.27
8 0.31
9 0.39
10 0.44
11 0.5
12 0.55
13 0.54
14 0.54
15 0.54
16 0.47
17 0.38
18 0.31
19 0.23
20 0.14
21 0.11
22 0.08
23 0.05
24 0.05
25 0.05
26 0.05
27 0.04
28 0.05
29 0.07
30 0.09
31 0.1
32 0.12
33 0.13
34 0.14
35 0.16
36 0.15
37 0.14
38 0.12
39 0.12
40 0.09
41 0.07
42 0.07
43 0.05
44 0.05
45 0.04
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.09
82 0.12
83 0.12
84 0.13
85 0.13
86 0.13
87 0.15
88 0.14
89 0.13
90 0.12
91 0.14
92 0.15
93 0.15
94 0.15
95 0.13
96 0.13
97 0.12
98 0.1
99 0.08
100 0.05
101 0.05
102 0.05
103 0.05
104 0.04
105 0.02
106 0.03
107 0.02
108 0.02
109 0.02
110 0.02
111 0.03
112 0.02
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.06
120 0.07
121 0.08
122 0.08
123 0.09
124 0.1
125 0.12
126 0.14
127 0.13
128 0.13
129 0.13
130 0.13
131 0.13
132 0.13
133 0.12
134 0.09
135 0.09
136 0.09
137 0.08
138 0.07
139 0.08
140 0.11
141 0.12
142 0.14
143 0.15
144 0.16
145 0.19
146 0.22
147 0.22
148 0.25
149 0.27
150 0.32
151 0.35
152 0.34
153 0.31
154 0.29
155 0.27
156 0.21
157 0.18
158 0.11
159 0.08
160 0.08
161 0.09
162 0.09
163 0.11
164 0.17
165 0.22
166 0.3
167 0.41
168 0.5
169 0.6
170 0.7
171 0.8
172 0.84
173 0.91
174 0.94
175 0.94
176 0.96
177 0.96
178 0.96
179 0.95
180 0.94
181 0.9
182 0.88
183 0.78
184 0.7
185 0.63
186 0.53
187 0.44
188 0.34