Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X6N391

Protein Details
Accession A0A1X6N391    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
102-131AFKIQTIQKNKKNKKNKKNKKNHCNIDNAYHydrophilic
NLS Segment(s)
PositionSequence
110-122KNKKNKKNKKNKK
Subcellular Location(s) nucl 13, extr 7, mito_nucl 7
Family & Domain DBs
Amino Acid Sequences MREFQVLLSSILEACGGGSVLVDSTLRDDGWQLQWGAVDFRNQGKSKSALKTLCAVPGILPRPSKKAWENSTRWWYESKELTVTQGKVQQFLKFMSDLCILAFKIQTIQKNKKNKKNKKNKKNHCNIDNAYDNSPYTIPVYSDHLCMSPTHTNSVSEPESEEAGGASARELSSNDDVPLVQKVEFQSAVDEGIMESDEDPETEQLLAEAARAATTRKLQKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.05
10 0.05
11 0.08
12 0.09
13 0.09
14 0.09
15 0.1
16 0.13
17 0.16
18 0.19
19 0.17
20 0.17
21 0.18
22 0.18
23 0.2
24 0.17
25 0.17
26 0.16
27 0.2
28 0.27
29 0.27
30 0.28
31 0.3
32 0.34
33 0.38
34 0.41
35 0.44
36 0.38
37 0.39
38 0.42
39 0.4
40 0.37
41 0.31
42 0.26
43 0.2
44 0.25
45 0.26
46 0.24
47 0.27
48 0.25
49 0.3
50 0.31
51 0.36
52 0.35
53 0.41
54 0.45
55 0.51
56 0.54
57 0.57
58 0.64
59 0.6
60 0.55
61 0.49
62 0.43
63 0.39
64 0.37
65 0.31
66 0.25
67 0.24
68 0.27
69 0.28
70 0.27
71 0.24
72 0.26
73 0.24
74 0.25
75 0.26
76 0.24
77 0.21
78 0.21
79 0.21
80 0.15
81 0.15
82 0.15
83 0.15
84 0.13
85 0.11
86 0.12
87 0.1
88 0.1
89 0.1
90 0.07
91 0.1
92 0.12
93 0.18
94 0.24
95 0.33
96 0.39
97 0.5
98 0.59
99 0.65
100 0.74
101 0.79
102 0.82
103 0.86
104 0.9
105 0.9
106 0.93
107 0.94
108 0.94
109 0.94
110 0.92
111 0.86
112 0.83
113 0.73
114 0.68
115 0.63
116 0.54
117 0.45
118 0.36
119 0.31
120 0.23
121 0.22
122 0.16
123 0.11
124 0.1
125 0.09
126 0.09
127 0.14
128 0.14
129 0.15
130 0.15
131 0.14
132 0.14
133 0.14
134 0.18
135 0.19
136 0.19
137 0.21
138 0.22
139 0.22
140 0.23
141 0.28
142 0.23
143 0.18
144 0.18
145 0.16
146 0.15
147 0.14
148 0.13
149 0.08
150 0.07
151 0.07
152 0.06
153 0.05
154 0.05
155 0.05
156 0.06
157 0.06
158 0.1
159 0.13
160 0.15
161 0.15
162 0.14
163 0.14
164 0.15
165 0.17
166 0.14
167 0.12
168 0.13
169 0.14
170 0.18
171 0.18
172 0.17
173 0.16
174 0.15
175 0.16
176 0.13
177 0.11
178 0.07
179 0.08
180 0.08
181 0.06
182 0.06
183 0.07
184 0.07
185 0.07
186 0.09
187 0.09
188 0.09
189 0.09
190 0.09
191 0.07
192 0.08
193 0.08
194 0.07
195 0.08
196 0.07
197 0.07
198 0.08
199 0.1
200 0.14
201 0.22