Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X6N025

Protein Details
Accession A0A1X6N025    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
246-265KQPTRHKEMNEKKRYRCTLCHydrophilic
268-300HRTFTRRGDARRHIRKSCKRSIHKVDQCPRCGDBasic
315-334CTGIPSKKRGHDKRDSGVGDBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, pero 4
Family & Domain DBs
Amino Acid Sequences MSNLENEIHTLRNLQRLFHEAFPEHLYDSTAVYLRGATSSVLAALGPRIAVMTRTRATESILSSIDTSAETIAVDGSTNIHIVRRLEDLTTVAYLGNAALVREEAALVVWADTELSVVDTFCGIELKIKNALQGQWPCNLPGPTELWDTLGYLGAEYQQPRFSVKSVPSNRYWPSAPPFEDIWSQSALADARSPKQLVPSLWALTPPPIRDIITIRTLTTTFHHEHEGDDLDLAGHIPFGRPPEGKQPTRHKEMNEKKRYRCTLCHTHRTFTRRGDARRHIRKSCKRSIHKVDQCPRCGDTLSRNDSVQRHAPICTGIPSKKRGHDKRDSGVGDDSFDARGRSDDELDRFIDLIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.35
4 0.39
5 0.37
6 0.39
7 0.31
8 0.34
9 0.35
10 0.33
11 0.29
12 0.25
13 0.23
14 0.17
15 0.18
16 0.17
17 0.15
18 0.14
19 0.13
20 0.13
21 0.11
22 0.11
23 0.11
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.05
35 0.06
36 0.06
37 0.09
38 0.11
39 0.17
40 0.18
41 0.21
42 0.23
43 0.23
44 0.26
45 0.28
46 0.27
47 0.24
48 0.23
49 0.21
50 0.2
51 0.19
52 0.17
53 0.13
54 0.11
55 0.08
56 0.07
57 0.06
58 0.05
59 0.06
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.07
66 0.07
67 0.08
68 0.1
69 0.11
70 0.13
71 0.15
72 0.15
73 0.15
74 0.16
75 0.16
76 0.15
77 0.14
78 0.12
79 0.09
80 0.08
81 0.08
82 0.06
83 0.07
84 0.06
85 0.05
86 0.05
87 0.05
88 0.06
89 0.06
90 0.06
91 0.04
92 0.04
93 0.05
94 0.05
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.03
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.05
109 0.05
110 0.04
111 0.09
112 0.1
113 0.12
114 0.17
115 0.17
116 0.19
117 0.21
118 0.22
119 0.24
120 0.3
121 0.29
122 0.28
123 0.29
124 0.28
125 0.29
126 0.28
127 0.22
128 0.17
129 0.18
130 0.17
131 0.18
132 0.17
133 0.15
134 0.14
135 0.14
136 0.12
137 0.11
138 0.09
139 0.07
140 0.07
141 0.06
142 0.08
143 0.08
144 0.09
145 0.1
146 0.1
147 0.12
148 0.13
149 0.13
150 0.16
151 0.19
152 0.28
153 0.32
154 0.35
155 0.36
156 0.4
157 0.4
158 0.39
159 0.36
160 0.29
161 0.28
162 0.29
163 0.28
164 0.25
165 0.24
166 0.23
167 0.24
168 0.22
169 0.19
170 0.15
171 0.13
172 0.1
173 0.11
174 0.09
175 0.08
176 0.09
177 0.09
178 0.1
179 0.12
180 0.13
181 0.12
182 0.15
183 0.18
184 0.16
185 0.19
186 0.2
187 0.19
188 0.19
189 0.19
190 0.16
191 0.17
192 0.18
193 0.15
194 0.14
195 0.14
196 0.14
197 0.15
198 0.18
199 0.17
200 0.2
201 0.2
202 0.19
203 0.19
204 0.18
205 0.18
206 0.16
207 0.18
208 0.15
209 0.16
210 0.19
211 0.18
212 0.18
213 0.19
214 0.19
215 0.14
216 0.12
217 0.11
218 0.08
219 0.08
220 0.08
221 0.05
222 0.04
223 0.04
224 0.04
225 0.05
226 0.08
227 0.12
228 0.12
229 0.14
230 0.25
231 0.33
232 0.38
233 0.45
234 0.54
235 0.58
236 0.65
237 0.66
238 0.59
239 0.62
240 0.69
241 0.71
242 0.72
243 0.73
244 0.72
245 0.78
246 0.82
247 0.77
248 0.74
249 0.71
250 0.71
251 0.72
252 0.76
253 0.7
254 0.68
255 0.69
256 0.67
257 0.65
258 0.59
259 0.59
260 0.56
261 0.59
262 0.62
263 0.66
264 0.71
265 0.76
266 0.79
267 0.78
268 0.81
269 0.85
270 0.85
271 0.85
272 0.85
273 0.83
274 0.86
275 0.87
276 0.88
277 0.87
278 0.88
279 0.87
280 0.85
281 0.81
282 0.74
283 0.65
284 0.56
285 0.49
286 0.42
287 0.41
288 0.42
289 0.44
290 0.42
291 0.41
292 0.44
293 0.44
294 0.47
295 0.44
296 0.4
297 0.35
298 0.34
299 0.34
300 0.31
301 0.31
302 0.31
303 0.31
304 0.32
305 0.36
306 0.42
307 0.48
308 0.54
309 0.63
310 0.67
311 0.7
312 0.74
313 0.77
314 0.78
315 0.81
316 0.74
317 0.67
318 0.63
319 0.54
320 0.45
321 0.38
322 0.31
323 0.23
324 0.23
325 0.19
326 0.14
327 0.15
328 0.16
329 0.18
330 0.21
331 0.26
332 0.28
333 0.31
334 0.31
335 0.3