Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X6NAP0

Protein Details
Accession A0A1X6NAP0    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
123-146SVGCVTHARRKERRRRVPTDIVSSHydrophilic
NLS Segment(s)
PositionSequence
131-138RRKERRRR
Subcellular Location(s) mito 14, nucl 5.5, cyto_nucl 5.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGKAMPAALPGPPRPDGGTSNAAIVTGQLSRLLPIVPSNDNITLPRSMGPPASPVLCLENHSETQERCIYLSLLSGCFGLDALELGFTSITAALPPKLPLIYASAVAAEGKTRTQGHMTGLTSVGCVTHARRKERRRRVPTDIVSSGAASVVADFLGDPSNEGDARRRRRGATCTATTVHSRQSRRHDVGDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.28
4 0.29
5 0.31
6 0.27
7 0.27
8 0.25
9 0.23
10 0.19
11 0.17
12 0.12
13 0.08
14 0.08
15 0.08
16 0.08
17 0.09
18 0.1
19 0.1
20 0.09
21 0.1
22 0.14
23 0.14
24 0.16
25 0.18
26 0.19
27 0.19
28 0.2
29 0.2
30 0.17
31 0.16
32 0.16
33 0.14
34 0.14
35 0.14
36 0.14
37 0.13
38 0.14
39 0.14
40 0.13
41 0.13
42 0.14
43 0.13
44 0.14
45 0.15
46 0.17
47 0.17
48 0.19
49 0.21
50 0.18
51 0.22
52 0.23
53 0.2
54 0.17
55 0.17
56 0.16
57 0.13
58 0.15
59 0.12
60 0.1
61 0.1
62 0.1
63 0.08
64 0.08
65 0.07
66 0.05
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.05
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.09
88 0.09
89 0.09
90 0.08
91 0.08
92 0.08
93 0.08
94 0.07
95 0.05
96 0.05
97 0.04
98 0.07
99 0.08
100 0.09
101 0.11
102 0.12
103 0.14
104 0.18
105 0.19
106 0.17
107 0.17
108 0.16
109 0.14
110 0.13
111 0.11
112 0.07
113 0.07
114 0.09
115 0.15
116 0.21
117 0.29
118 0.39
119 0.5
120 0.6
121 0.7
122 0.79
123 0.82
124 0.84
125 0.85
126 0.87
127 0.82
128 0.79
129 0.69
130 0.6
131 0.51
132 0.42
133 0.33
134 0.23
135 0.16
136 0.08
137 0.06
138 0.04
139 0.04
140 0.03
141 0.03
142 0.04
143 0.06
144 0.06
145 0.07
146 0.07
147 0.1
148 0.11
149 0.12
150 0.2
151 0.27
152 0.36
153 0.44
154 0.47
155 0.5
156 0.57
157 0.62
158 0.64
159 0.64
160 0.6
161 0.56
162 0.54
163 0.52
164 0.5
165 0.46
166 0.44
167 0.43
168 0.43
169 0.45
170 0.54
171 0.61
172 0.62