Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X6MYK6

Protein Details
Accession A0A1X6MYK6    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
169-192EKKARRLTNRHWRVIKRNLKRIGHBasic
NLS Segment(s)
PositionSequence
45-45K
173-174RR
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MPKAKPFIITTKHEPTGLLERIAIHNMHKFNDVGKPRRIVRPTIKPLIRRPFNPERAEKAKHDIEELALRAHLFKKQQLLDRISDPAPPLIDRIDMQAGPSYEYKPPKPLPDIHFQRTKILLRTSDRQADRLEPVFARMEKEEGSLEPEVVAKVRRMGDGFDELYHGLEKKARRLTNRHWRVIKRNLKRIGHVSFEDLSSRLPDICNELASLNITFKYKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.43
3 0.45
4 0.41
5 0.33
6 0.26
7 0.26
8 0.27
9 0.29
10 0.25
11 0.19
12 0.23
13 0.24
14 0.25
15 0.25
16 0.23
17 0.23
18 0.31
19 0.37
20 0.37
21 0.41
22 0.46
23 0.48
24 0.57
25 0.58
26 0.57
27 0.58
28 0.63
29 0.65
30 0.69
31 0.7
32 0.67
33 0.73
34 0.75
35 0.72
36 0.63
37 0.64
38 0.65
39 0.68
40 0.68
41 0.64
42 0.61
43 0.62
44 0.64
45 0.58
46 0.54
47 0.5
48 0.44
49 0.4
50 0.33
51 0.28
52 0.27
53 0.25
54 0.18
55 0.14
56 0.13
57 0.13
58 0.14
59 0.15
60 0.14
61 0.15
62 0.21
63 0.25
64 0.31
65 0.37
66 0.39
67 0.38
68 0.38
69 0.39
70 0.32
71 0.3
72 0.24
73 0.19
74 0.16
75 0.13
76 0.12
77 0.1
78 0.1
79 0.09
80 0.1
81 0.11
82 0.1
83 0.1
84 0.12
85 0.11
86 0.12
87 0.13
88 0.13
89 0.15
90 0.19
91 0.19
92 0.23
93 0.25
94 0.26
95 0.29
96 0.33
97 0.34
98 0.41
99 0.46
100 0.45
101 0.49
102 0.46
103 0.45
104 0.43
105 0.4
106 0.33
107 0.3
108 0.3
109 0.28
110 0.32
111 0.34
112 0.38
113 0.36
114 0.35
115 0.33
116 0.31
117 0.3
118 0.27
119 0.25
120 0.17
121 0.18
122 0.19
123 0.18
124 0.18
125 0.15
126 0.15
127 0.14
128 0.15
129 0.14
130 0.11
131 0.14
132 0.12
133 0.12
134 0.11
135 0.11
136 0.1
137 0.1
138 0.11
139 0.08
140 0.12
141 0.13
142 0.14
143 0.14
144 0.15
145 0.17
146 0.2
147 0.2
148 0.16
149 0.16
150 0.15
151 0.15
152 0.15
153 0.13
154 0.1
155 0.13
156 0.15
157 0.22
158 0.3
159 0.34
160 0.4
161 0.48
162 0.58
163 0.65
164 0.72
165 0.74
166 0.74
167 0.77
168 0.8
169 0.82
170 0.82
171 0.8
172 0.81
173 0.81
174 0.77
175 0.75
176 0.73
177 0.67
178 0.63
179 0.54
180 0.48
181 0.4
182 0.37
183 0.33
184 0.25
185 0.22
186 0.18
187 0.17
188 0.14
189 0.13
190 0.13
191 0.18
192 0.19
193 0.19
194 0.18
195 0.17
196 0.17
197 0.18
198 0.18
199 0.14
200 0.15