Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H0EIJ2

Protein Details
Accession H0EIJ2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
90-109SSFESIKKKRRIVNESKTNIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, extr 7, mito 6, pero 2, cyto 1, E.R. 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAASHARDFSAKQLSWIFIPILLILFVLGAIIFGRYYSRRRRATRQLIAAGVVSQDLEKAAANAHRSISHVPLPAPYYGREHPGSGSDSSSFESIKKKRRIVNESKTNIFNSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.29
4 0.23
5 0.15
6 0.16
7 0.12
8 0.1
9 0.09
10 0.08
11 0.05
12 0.05
13 0.04
14 0.03
15 0.03
16 0.02
17 0.03
18 0.03
19 0.03
20 0.03
21 0.05
22 0.08
23 0.14
24 0.24
25 0.33
26 0.42
27 0.47
28 0.56
29 0.65
30 0.73
31 0.75
32 0.71
33 0.65
34 0.56
35 0.51
36 0.42
37 0.32
38 0.21
39 0.13
40 0.07
41 0.04
42 0.04
43 0.03
44 0.04
45 0.03
46 0.03
47 0.05
48 0.07
49 0.08
50 0.09
51 0.1
52 0.1
53 0.12
54 0.14
55 0.15
56 0.17
57 0.16
58 0.16
59 0.17
60 0.19
61 0.18
62 0.18
63 0.17
64 0.19
65 0.19
66 0.24
67 0.23
68 0.22
69 0.21
70 0.22
71 0.24
72 0.19
73 0.2
74 0.16
75 0.16
76 0.17
77 0.17
78 0.15
79 0.14
80 0.23
81 0.28
82 0.37
83 0.45
84 0.5
85 0.56
86 0.66
87 0.74
88 0.76
89 0.79
90 0.8
91 0.78
92 0.77
93 0.74