Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4R0M7

Protein Details
Accession C4R0M7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-45AGKKTSSSSEPKKRSKVRKESYASYHydrophilic
NLS Segment(s)
PositionSequence
4-39KAEKKPASKAPAEKKPTAGKKTSSSSEPKKRSKVRK
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0035861  C:site of double-strand break  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
KEGG ppa:PAS_chr2-1_0428  -  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPKAEKKPASKAPAEKKPTAGKKTSSSSEPKKRSKVRKESYASYIYKVLKQTHPDTGISQKAMSIMNSFVNDIFERIASEASKLASYNKKSTISAREIQTAVRLILPGELSKHAVSEGTRAVTKYTSSTQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.69
4 0.67
5 0.69
6 0.71
7 0.68
8 0.63
9 0.58
10 0.58
11 0.61
12 0.58
13 0.54
14 0.54
15 0.57
16 0.62
17 0.67
18 0.68
19 0.72
20 0.78
21 0.83
22 0.85
23 0.86
24 0.84
25 0.84
26 0.82
27 0.77
28 0.74
29 0.71
30 0.61
31 0.51
32 0.48
33 0.39
34 0.36
35 0.35
36 0.33
37 0.29
38 0.33
39 0.33
40 0.33
41 0.34
42 0.32
43 0.3
44 0.31
45 0.29
46 0.24
47 0.21
48 0.16
49 0.15
50 0.15
51 0.13
52 0.09
53 0.08
54 0.09
55 0.09
56 0.09
57 0.08
58 0.09
59 0.09
60 0.08
61 0.07
62 0.06
63 0.06
64 0.07
65 0.08
66 0.06
67 0.07
68 0.07
69 0.08
70 0.08
71 0.08
72 0.12
73 0.18
74 0.22
75 0.25
76 0.29
77 0.31
78 0.32
79 0.36
80 0.39
81 0.38
82 0.4
83 0.38
84 0.38
85 0.36
86 0.35
87 0.33
88 0.28
89 0.22
90 0.17
91 0.15
92 0.11
93 0.12
94 0.13
95 0.11
96 0.11
97 0.12
98 0.15
99 0.14
100 0.15
101 0.13
102 0.14
103 0.14
104 0.15
105 0.17
106 0.17
107 0.19
108 0.19
109 0.21
110 0.21
111 0.21
112 0.22