Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EGS7

Protein Details
Accession H0EGS7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
45-69FEELCKKKDTPKKKAGEKGTERSRTBasic
NLS Segment(s)
PositionSequence
52-62KDTPKKKAGEK
Subcellular Location(s) nucl 12cyto 12cyto_nucl 12
Family & Domain DBs
Amino Acid Sequences MAEPPLKKLKKDFDHFTAPLKVLVGDNGQEFYINEQLICSMSKLFEELCKKKDTPKKKAGEKGTERSRTFAPPDEDPNIFALFLVWLTNGNIDAAEDLVQIRSSPLGGLRCEALKKLVKEMDLRFFQLVDCYYLGSDIQSEEFQNFVMDSIVDLVTERTSQTGSVPKGEISALASSTKEIHEIYVKTWADSPLRMFLHRYHLCEQVLMTPAYVQELIELGCHDYISDVITESARFYTRPVGASRFRTGKMDAVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.68
3 0.65
4 0.6
5 0.51
6 0.44
7 0.36
8 0.3
9 0.22
10 0.22
11 0.18
12 0.15
13 0.15
14 0.14
15 0.14
16 0.13
17 0.13
18 0.14
19 0.16
20 0.14
21 0.13
22 0.12
23 0.13
24 0.14
25 0.14
26 0.12
27 0.08
28 0.09
29 0.09
30 0.1
31 0.1
32 0.16
33 0.25
34 0.29
35 0.32
36 0.37
37 0.38
38 0.46
39 0.55
40 0.59
41 0.6
42 0.65
43 0.71
44 0.75
45 0.83
46 0.82
47 0.83
48 0.81
49 0.81
50 0.8
51 0.8
52 0.71
53 0.65
54 0.58
55 0.52
56 0.47
57 0.44
58 0.37
59 0.32
60 0.36
61 0.37
62 0.35
63 0.31
64 0.3
65 0.23
66 0.19
67 0.16
68 0.11
69 0.07
70 0.07
71 0.06
72 0.04
73 0.05
74 0.05
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.05
86 0.05
87 0.05
88 0.05
89 0.04
90 0.04
91 0.04
92 0.07
93 0.09
94 0.09
95 0.1
96 0.11
97 0.12
98 0.12
99 0.12
100 0.14
101 0.17
102 0.17
103 0.21
104 0.22
105 0.22
106 0.26
107 0.28
108 0.3
109 0.26
110 0.27
111 0.23
112 0.21
113 0.19
114 0.16
115 0.14
116 0.09
117 0.08
118 0.07
119 0.07
120 0.07
121 0.07
122 0.06
123 0.05
124 0.04
125 0.05
126 0.05
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.05
133 0.05
134 0.04
135 0.04
136 0.04
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.06
144 0.06
145 0.05
146 0.06
147 0.06
148 0.08
149 0.14
150 0.14
151 0.17
152 0.17
153 0.17
154 0.17
155 0.17
156 0.15
157 0.11
158 0.11
159 0.09
160 0.09
161 0.09
162 0.09
163 0.1
164 0.1
165 0.1
166 0.09
167 0.09
168 0.14
169 0.14
170 0.15
171 0.23
172 0.22
173 0.22
174 0.24
175 0.25
176 0.22
177 0.23
178 0.24
179 0.23
180 0.24
181 0.24
182 0.25
183 0.24
184 0.33
185 0.35
186 0.38
187 0.34
188 0.38
189 0.38
190 0.36
191 0.34
192 0.27
193 0.27
194 0.22
195 0.19
196 0.14
197 0.14
198 0.15
199 0.15
200 0.1
201 0.07
202 0.08
203 0.08
204 0.08
205 0.09
206 0.08
207 0.08
208 0.08
209 0.08
210 0.07
211 0.07
212 0.08
213 0.07
214 0.07
215 0.08
216 0.09
217 0.09
218 0.1
219 0.12
220 0.12
221 0.12
222 0.13
223 0.19
224 0.22
225 0.25
226 0.27
227 0.32
228 0.39
229 0.44
230 0.51
231 0.48
232 0.47
233 0.47
234 0.46