Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X6MLA3

Protein Details
Accession A0A1X6MLA3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
153-174AEKERMKEARDKEKGKKRTHGKBasic
NLS Segment(s)
PositionSequence
155-174KERMKEARDKEKGKKRTHGK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023139  PBDC1-like_dom_sf  
IPR008476  PBDC1_metazoa/fungi  
Pfam View protein in Pfam  
PF04669  Polysacc_synt_4  
Amino Acid Sequences MTTKFDPNNAQNAIEIEKQFAVKAVEHAQTYWNLLEKVPPRNLKLTKLDDDIFEHTMRDFPELAENDHEKVTKLDEDWMKSKDGKERWRKFIQAYEKTVKDYNFGSLIRTDAREEYGEKNTIFVTRMQFYAFEIARNRLGLNDQAHELAKQEAEKERMKEARDKEKGKKRTHGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.22
4 0.21
5 0.21
6 0.2
7 0.2
8 0.18
9 0.14
10 0.18
11 0.21
12 0.22
13 0.23
14 0.23
15 0.23
16 0.22
17 0.23
18 0.2
19 0.18
20 0.16
21 0.15
22 0.21
23 0.24
24 0.3
25 0.36
26 0.39
27 0.39
28 0.47
29 0.5
30 0.5
31 0.53
32 0.52
33 0.48
34 0.48
35 0.46
36 0.38
37 0.38
38 0.35
39 0.3
40 0.23
41 0.2
42 0.16
43 0.17
44 0.16
45 0.15
46 0.12
47 0.1
48 0.16
49 0.17
50 0.18
51 0.2
52 0.2
53 0.2
54 0.2
55 0.2
56 0.14
57 0.14
58 0.14
59 0.11
60 0.11
61 0.15
62 0.17
63 0.2
64 0.22
65 0.23
66 0.23
67 0.23
68 0.25
69 0.26
70 0.3
71 0.37
72 0.45
73 0.5
74 0.56
75 0.59
76 0.59
77 0.54
78 0.55
79 0.56
80 0.51
81 0.5
82 0.48
83 0.45
84 0.45
85 0.46
86 0.38
87 0.3
88 0.24
89 0.2
90 0.17
91 0.17
92 0.15
93 0.13
94 0.14
95 0.14
96 0.14
97 0.13
98 0.11
99 0.13
100 0.13
101 0.15
102 0.17
103 0.19
104 0.21
105 0.2
106 0.2
107 0.19
108 0.19
109 0.18
110 0.17
111 0.17
112 0.16
113 0.17
114 0.16
115 0.16
116 0.16
117 0.21
118 0.18
119 0.18
120 0.19
121 0.21
122 0.22
123 0.23
124 0.22
125 0.16
126 0.19
127 0.21
128 0.21
129 0.2
130 0.19
131 0.21
132 0.21
133 0.2
134 0.19
135 0.16
136 0.15
137 0.14
138 0.16
139 0.2
140 0.25
141 0.3
142 0.31
143 0.38
144 0.41
145 0.44
146 0.48
147 0.51
148 0.57
149 0.61
150 0.66
151 0.69
152 0.75
153 0.81
154 0.81