Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EVP7

Protein Details
Accession H0EVP7   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-47AIPKPFRSAHWKPNQRRNKNIKTIIGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 10.5, nucl 8.5, cysk 4
Family & Domain DBs
Amino Acid Sequences MAPPTPEAEAHQILIDQLDIHAIPKPFRSAHWKPNQRRNKNIKTIIGDVIRKEASTMATQDNSGAVTPLPDDSVTLHGICNFTTKSSTGITEPIKISPGKEHEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.07
4 0.06
5 0.06
6 0.06
7 0.06
8 0.1
9 0.11
10 0.12
11 0.14
12 0.18
13 0.17
14 0.2
15 0.29
16 0.32
17 0.41
18 0.51
19 0.59
20 0.64
21 0.74
22 0.82
23 0.8
24 0.84
25 0.84
26 0.83
27 0.83
28 0.8
29 0.74
30 0.68
31 0.63
32 0.57
33 0.5
34 0.41
35 0.32
36 0.29
37 0.24
38 0.19
39 0.16
40 0.13
41 0.1
42 0.1
43 0.12
44 0.11
45 0.11
46 0.11
47 0.11
48 0.1
49 0.09
50 0.08
51 0.07
52 0.05
53 0.04
54 0.05
55 0.05
56 0.06
57 0.05
58 0.06
59 0.06
60 0.09
61 0.1
62 0.1
63 0.1
64 0.11
65 0.12
66 0.12
67 0.14
68 0.12
69 0.12
70 0.14
71 0.14
72 0.15
73 0.16
74 0.18
75 0.16
76 0.22
77 0.22
78 0.26
79 0.26
80 0.25
81 0.27
82 0.25
83 0.26
84 0.27