Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X6N8L9

Protein Details
Accession A0A1X6N8L9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-41KTPWKLSPTRKANARKRLKRVDSVHydrophilic
NLS Segment(s)
PositionSequence
27-36RKANARKRLK
Subcellular Location(s) mito 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGAFRQTQVSLGGLLWKTPWKLSPTRKANARKRLKRVDSVIEAVRASGVECASLVKALELPKEHEMPARDKYTVFTRHARGYRKGIHKVPKWTRLTLRTNPTGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.17
5 0.17
6 0.18
7 0.22
8 0.22
9 0.31
10 0.39
11 0.49
12 0.53
13 0.59
14 0.66
15 0.72
16 0.77
17 0.79
18 0.81
19 0.8
20 0.82
21 0.85
22 0.82
23 0.78
24 0.73
25 0.69
26 0.61
27 0.56
28 0.47
29 0.38
30 0.33
31 0.25
32 0.2
33 0.14
34 0.1
35 0.07
36 0.06
37 0.04
38 0.04
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.06
45 0.07
46 0.09
47 0.1
48 0.13
49 0.15
50 0.17
51 0.17
52 0.19
53 0.2
54 0.22
55 0.27
56 0.26
57 0.24
58 0.23
59 0.25
60 0.29
61 0.33
62 0.33
63 0.33
64 0.35
65 0.42
66 0.49
67 0.52
68 0.5
69 0.53
70 0.58
71 0.6
72 0.65
73 0.64
74 0.68
75 0.69
76 0.75
77 0.76
78 0.77
79 0.73
80 0.72
81 0.73
82 0.72
83 0.73
84 0.71
85 0.7