Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X6N790

Protein Details
Accession A0A1X6N790    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
97-118LDYYKQKTKKAKEAQQRAFRKLHydrophilic
120-140KPYATRLRKPLPKRKPPPAASHydrophilic
NLS Segment(s)
PositionSequence
103-137KTKKAKEAQQRAFRKLAKPYATRLRKPLPKRKPPP
Subcellular Location(s) nucl 17, cyto_nucl 11.5, cyto 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006594  LisH  
Pfam View protein in Pfam  
PF08513  LisH  
PROSITE View protein in PROSITE  
PS50896  LISH  
Amino Acid Sequences MATNIGLDPCEWPERPSTPWDGEVMFNAYIYEYLAKRGYVATAHALLKEARLPKGYKPPILTPQGLLYESAQWWCTFWVFFEGNREGSDYDDLNTYLDYYKQKTKKAKEAQQRAFRKLAKPYATRLRKPLPKRKPPPAASEIPATSPYEPESRSSAAQHACSSEVPISVCPQMEQPLVVQPVHHYQYSGQHWVDPASYAEAAAPVQHEHTTWEAGVLSGHQPMYQTEDQAFAFLGAPHEISSGQTEQLNYTPQNSPSSIESSISPTTPTFLQHFSNGYTEQMPWNMKAAYSPPVADAGNIYQPQADYDWQLGGFLPSTDNTPAFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.33
4 0.36
5 0.34
6 0.35
7 0.36
8 0.32
9 0.3
10 0.29
11 0.28
12 0.21
13 0.17
14 0.16
15 0.14
16 0.12
17 0.12
18 0.14
19 0.1
20 0.14
21 0.15
22 0.15
23 0.15
24 0.16
25 0.16
26 0.13
27 0.15
28 0.16
29 0.19
30 0.2
31 0.2
32 0.21
33 0.19
34 0.2
35 0.23
36 0.23
37 0.21
38 0.25
39 0.27
40 0.31
41 0.42
42 0.47
43 0.47
44 0.47
45 0.51
46 0.55
47 0.58
48 0.53
49 0.44
50 0.42
51 0.39
52 0.35
53 0.29
54 0.22
55 0.19
56 0.19
57 0.18
58 0.15
59 0.13
60 0.13
61 0.13
62 0.13
63 0.1
64 0.1
65 0.14
66 0.14
67 0.15
68 0.21
69 0.22
70 0.22
71 0.23
72 0.23
73 0.18
74 0.18
75 0.2
76 0.14
77 0.12
78 0.13
79 0.12
80 0.11
81 0.11
82 0.1
83 0.09
84 0.11
85 0.13
86 0.16
87 0.25
88 0.29
89 0.37
90 0.45
91 0.52
92 0.59
93 0.67
94 0.72
95 0.74
96 0.8
97 0.82
98 0.83
99 0.82
100 0.76
101 0.73
102 0.67
103 0.61
104 0.58
105 0.56
106 0.53
107 0.49
108 0.51
109 0.55
110 0.59
111 0.57
112 0.57
113 0.58
114 0.59
115 0.67
116 0.71
117 0.71
118 0.74
119 0.79
120 0.83
121 0.84
122 0.8
123 0.78
124 0.73
125 0.66
126 0.57
127 0.53
128 0.43
129 0.34
130 0.31
131 0.24
132 0.18
133 0.14
134 0.14
135 0.13
136 0.13
137 0.13
138 0.15
139 0.15
140 0.16
141 0.16
142 0.19
143 0.18
144 0.19
145 0.18
146 0.16
147 0.15
148 0.14
149 0.14
150 0.1
151 0.1
152 0.09
153 0.09
154 0.1
155 0.1
156 0.1
157 0.09
158 0.09
159 0.1
160 0.1
161 0.1
162 0.09
163 0.12
164 0.13
165 0.13
166 0.12
167 0.11
168 0.16
169 0.18
170 0.17
171 0.14
172 0.13
173 0.21
174 0.24
175 0.27
176 0.22
177 0.21
178 0.21
179 0.22
180 0.21
181 0.15
182 0.12
183 0.09
184 0.09
185 0.08
186 0.08
187 0.07
188 0.07
189 0.07
190 0.07
191 0.05
192 0.07
193 0.07
194 0.07
195 0.08
196 0.1
197 0.1
198 0.1
199 0.1
200 0.08
201 0.08
202 0.08
203 0.08
204 0.07
205 0.08
206 0.08
207 0.08
208 0.08
209 0.09
210 0.16
211 0.15
212 0.16
213 0.14
214 0.17
215 0.16
216 0.16
217 0.16
218 0.09
219 0.09
220 0.09
221 0.09
222 0.08
223 0.08
224 0.08
225 0.08
226 0.08
227 0.08
228 0.11
229 0.11
230 0.11
231 0.13
232 0.13
233 0.14
234 0.15
235 0.18
236 0.16
237 0.18
238 0.21
239 0.21
240 0.24
241 0.24
242 0.24
243 0.23
244 0.26
245 0.23
246 0.21
247 0.2
248 0.21
249 0.22
250 0.2
251 0.19
252 0.15
253 0.16
254 0.16
255 0.18
256 0.16
257 0.18
258 0.19
259 0.21
260 0.22
261 0.22
262 0.25
263 0.23
264 0.22
265 0.2
266 0.19
267 0.19
268 0.22
269 0.23
270 0.2
271 0.23
272 0.22
273 0.2
274 0.21
275 0.21
276 0.21
277 0.21
278 0.21
279 0.18
280 0.2
281 0.2
282 0.18
283 0.18
284 0.16
285 0.21
286 0.21
287 0.2
288 0.19
289 0.19
290 0.2
291 0.2
292 0.19
293 0.14
294 0.15
295 0.17
296 0.16
297 0.16
298 0.15
299 0.14
300 0.13
301 0.11
302 0.11
303 0.1
304 0.13
305 0.16