Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EW35

Protein Details
Accession H0EW35   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
104-129EDSYLPRIKKGKKKSKVASKRAIFEEHydrophilic
NLS Segment(s)
PositionSequence
110-124RIKKGKKKSKVASKR
Subcellular Location(s) nucl 11, cyto_nucl 10.5, cyto 8, cysk 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR020850  GED_dom  
PROSITE View protein in PROSITE  
PS51388  GED  
Amino Acid Sequences MEAYYKVTLKRFVDDIAIEVIESKLISPLYDIFSPITVTSMSDDLLDVLMKGSETCKTFIGVRVLASEESKPLSRNIVERAVEPDPSEAIEIPEALDMPPAEEEDSYLPRIKKGKKKSKVASKRAIFEEPEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.21
4 0.19
5 0.15
6 0.14
7 0.13
8 0.09
9 0.09
10 0.07
11 0.07
12 0.07
13 0.07
14 0.08
15 0.1
16 0.13
17 0.13
18 0.14
19 0.12
20 0.13
21 0.14
22 0.12
23 0.11
24 0.08
25 0.08
26 0.09
27 0.08
28 0.08
29 0.07
30 0.07
31 0.06
32 0.07
33 0.06
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.07
41 0.09
42 0.1
43 0.1
44 0.11
45 0.12
46 0.16
47 0.18
48 0.16
49 0.15
50 0.14
51 0.15
52 0.14
53 0.14
54 0.1
55 0.08
56 0.09
57 0.09
58 0.09
59 0.09
60 0.11
61 0.12
62 0.14
63 0.17
64 0.21
65 0.21
66 0.21
67 0.25
68 0.23
69 0.23
70 0.21
71 0.18
72 0.13
73 0.12
74 0.12
75 0.08
76 0.08
77 0.08
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.07
84 0.06
85 0.07
86 0.07
87 0.07
88 0.08
89 0.07
90 0.09
91 0.1
92 0.13
93 0.14
94 0.19
95 0.19
96 0.23
97 0.31
98 0.39
99 0.46
100 0.55
101 0.64
102 0.69
103 0.79
104 0.85
105 0.89
106 0.91
107 0.91
108 0.91
109 0.87
110 0.84
111 0.79
112 0.73