Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X6NGA8

Protein Details
Accession A0A1X6NGA8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
96-118TPVTVAIKQKPKPPPKPKPPPKPHydrophilic
NLS Segment(s)
PositionSequence
103-118KQKPKPPPKPKPPPKP
Subcellular Location(s) cyto 15.5, cyto_nucl 13, nucl 7.5, mito 2
Family & Domain DBs
Amino Acid Sequences MAAVNPATENPAIADATPLSEDGSPLTEASTPEAPSALQLEDKELSVSATTGEGVALPSTRVPVAPDNDDEEGDDDDDDDDPEELDDIWILRGPPTPVTVAIKQKPKPPPKPKPPPKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.09
3 0.1
4 0.1
5 0.1
6 0.09
7 0.09
8 0.09
9 0.08
10 0.1
11 0.1
12 0.09
13 0.1
14 0.1
15 0.1
16 0.14
17 0.15
18 0.14
19 0.13
20 0.14
21 0.13
22 0.12
23 0.13
24 0.1
25 0.09
26 0.08
27 0.11
28 0.11
29 0.12
30 0.11
31 0.09
32 0.09
33 0.08
34 0.08
35 0.05
36 0.05
37 0.05
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.06
50 0.09
51 0.12
52 0.13
53 0.14
54 0.17
55 0.17
56 0.17
57 0.16
58 0.14
59 0.12
60 0.1
61 0.09
62 0.07
63 0.06
64 0.07
65 0.07
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.04
73 0.05
74 0.04
75 0.05
76 0.06
77 0.06
78 0.07
79 0.1
80 0.11
81 0.13
82 0.14
83 0.15
84 0.17
85 0.22
86 0.27
87 0.33
88 0.38
89 0.46
90 0.48
91 0.55
92 0.63
93 0.68
94 0.73
95 0.76
96 0.8
97 0.83
98 0.91