Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X6N5W9

Protein Details
Accession A0A1X6N5W9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
151-176LSRGSEWLNKRRKKRLAIRNSHAAAPHydrophilic
NLS Segment(s)
PositionSequence
160-165KRRKKR
Subcellular Location(s) nucl 13, mito 5, extr 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MTTERLEAWQLLTAAVPRDLCNTSGDNNASSVKHNVLNWRHFAANSSIIHGGFIAATCRTFGISETAPRVITWRAVLNAAKPILTVPSRIQIRLPEASFSRQGECRCENMGSGTAGMPRTPDPTQVDSGVLDSAMLKIPGYALRHQNAACLSRGSEWLNKRRKKRLAIRNSHAAAPTLEFAATTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.16
4 0.14
5 0.18
6 0.19
7 0.19
8 0.2
9 0.2
10 0.2
11 0.25
12 0.25
13 0.22
14 0.22
15 0.24
16 0.22
17 0.22
18 0.23
19 0.2
20 0.21
21 0.22
22 0.3
23 0.35
24 0.39
25 0.39
26 0.4
27 0.38
28 0.35
29 0.36
30 0.31
31 0.29
32 0.25
33 0.24
34 0.22
35 0.21
36 0.21
37 0.18
38 0.15
39 0.08
40 0.08
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.07
48 0.07
49 0.1
50 0.11
51 0.13
52 0.15
53 0.16
54 0.16
55 0.16
56 0.17
57 0.14
58 0.13
59 0.12
60 0.12
61 0.11
62 0.14
63 0.14
64 0.13
65 0.16
66 0.15
67 0.14
68 0.12
69 0.11
70 0.12
71 0.12
72 0.13
73 0.1
74 0.16
75 0.17
76 0.17
77 0.18
78 0.17
79 0.2
80 0.22
81 0.21
82 0.16
83 0.17
84 0.19
85 0.21
86 0.2
87 0.19
88 0.19
89 0.2
90 0.23
91 0.23
92 0.23
93 0.22
94 0.22
95 0.2
96 0.18
97 0.19
98 0.14
99 0.12
100 0.11
101 0.11
102 0.11
103 0.1
104 0.1
105 0.09
106 0.13
107 0.13
108 0.17
109 0.19
110 0.22
111 0.24
112 0.24
113 0.24
114 0.2
115 0.2
116 0.16
117 0.11
118 0.08
119 0.06
120 0.06
121 0.06
122 0.06
123 0.05
124 0.05
125 0.06
126 0.1
127 0.13
128 0.17
129 0.22
130 0.24
131 0.28
132 0.27
133 0.3
134 0.3
135 0.29
136 0.25
137 0.21
138 0.21
139 0.19
140 0.22
141 0.22
142 0.26
143 0.32
144 0.4
145 0.49
146 0.56
147 0.63
148 0.71
149 0.76
150 0.8
151 0.83
152 0.84
153 0.85
154 0.88
155 0.87
156 0.87
157 0.8
158 0.73
159 0.63
160 0.54
161 0.44
162 0.36
163 0.29
164 0.19
165 0.17