Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X6MN00

Protein Details
Accession A0A1X6MN00    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
88-111NFELARPRHRRLKKQFRGIVKEGLHydrophilic
NLS Segment(s)
PositionSequence
94-101PRHRRLKK
Subcellular Location(s) mito 23, cyto_mito 13.333, mito_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR003545  Telomerase_RT  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0003721  F:telomerase RNA reverse transcriptase activity  
Amino Acid Sequences MKMHHYLRQWGINVSKGTTFLRNTIQQMIRYTYATMRNKASNKVAKASGGCCTVQQAQVTWCVLGTHAFHAVLTRKPHMYPQLIKWLNFELARPRHRRLKKQFRGIVKEGLNTLTVLAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.31
3 0.27
4 0.28
5 0.28
6 0.26
7 0.23
8 0.27
9 0.29
10 0.31
11 0.36
12 0.37
13 0.35
14 0.37
15 0.38
16 0.34
17 0.31
18 0.29
19 0.26
20 0.32
21 0.33
22 0.33
23 0.32
24 0.37
25 0.39
26 0.42
27 0.45
28 0.43
29 0.41
30 0.41
31 0.39
32 0.34
33 0.33
34 0.3
35 0.25
36 0.2
37 0.18
38 0.15
39 0.16
40 0.16
41 0.17
42 0.16
43 0.13
44 0.12
45 0.14
46 0.14
47 0.11
48 0.1
49 0.08
50 0.07
51 0.08
52 0.08
53 0.07
54 0.08
55 0.08
56 0.08
57 0.1
58 0.12
59 0.15
60 0.17
61 0.18
62 0.19
63 0.19
64 0.24
65 0.28
66 0.32
67 0.32
68 0.33
69 0.42
70 0.43
71 0.43
72 0.41
73 0.38
74 0.35
75 0.31
76 0.28
77 0.27
78 0.32
79 0.41
80 0.44
81 0.47
82 0.54
83 0.63
84 0.72
85 0.74
86 0.78
87 0.8
88 0.85
89 0.87
90 0.87
91 0.87
92 0.8
93 0.77
94 0.69
95 0.61
96 0.52
97 0.45
98 0.36
99 0.27