Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X6N0K8

Protein Details
Accession A0A1X6N0K8    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
88-108DSSPQIPKKERARQPKPRGIAHydrophilic
NLS Segment(s)
PositionSequence
94-131PKKERARQPKPRGIASPSSRKAPRTPRSGGKPSSARKG
200-207KKSKGRKH
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
Amino Acid Sequences MDPPPSFSDTNPRPPPGPPVLGRSWTGTIADWVDNHFPGRNRSPTPYYHLPSPPLTEWPVETPWSAAPHTLQTEFPSSPLPARPVTPDSSPQIPKKERARQPKPRGIASPSSRKAPRTPRSGGKPSSARKGSQPQNPTLAGPSAPRRRAVTMPSSAETRQLMSRPLIPQLRPGQQCKSARLKEKAARLPSATQEAVSPTKKSKGRKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.54
3 0.5
4 0.5
5 0.43
6 0.43
7 0.44
8 0.46
9 0.45
10 0.42
11 0.37
12 0.31
13 0.29
14 0.22
15 0.2
16 0.19
17 0.19
18 0.15
19 0.16
20 0.17
21 0.17
22 0.18
23 0.19
24 0.2
25 0.25
26 0.31
27 0.35
28 0.36
29 0.42
30 0.44
31 0.44
32 0.5
33 0.52
34 0.49
35 0.48
36 0.48
37 0.45
38 0.43
39 0.45
40 0.37
41 0.32
42 0.3
43 0.25
44 0.23
45 0.22
46 0.22
47 0.19
48 0.17
49 0.15
50 0.16
51 0.17
52 0.16
53 0.14
54 0.13
55 0.15
56 0.17
57 0.17
58 0.15
59 0.15
60 0.18
61 0.18
62 0.17
63 0.16
64 0.15
65 0.15
66 0.16
67 0.17
68 0.14
69 0.15
70 0.18
71 0.19
72 0.21
73 0.21
74 0.22
75 0.23
76 0.28
77 0.31
78 0.31
79 0.36
80 0.36
81 0.41
82 0.47
83 0.54
84 0.56
85 0.63
86 0.7
87 0.73
88 0.8
89 0.81
90 0.75
91 0.68
92 0.63
93 0.56
94 0.54
95 0.48
96 0.48
97 0.43
98 0.45
99 0.44
100 0.43
101 0.46
102 0.48
103 0.5
104 0.47
105 0.51
106 0.52
107 0.59
108 0.64
109 0.59
110 0.55
111 0.56
112 0.53
113 0.57
114 0.52
115 0.45
116 0.43
117 0.5
118 0.51
119 0.5
120 0.51
121 0.45
122 0.47
123 0.46
124 0.41
125 0.33
126 0.27
127 0.2
128 0.19
129 0.25
130 0.29
131 0.3
132 0.32
133 0.33
134 0.36
135 0.38
136 0.4
137 0.37
138 0.35
139 0.37
140 0.36
141 0.37
142 0.33
143 0.33
144 0.29
145 0.25
146 0.21
147 0.19
148 0.2
149 0.19
150 0.24
151 0.23
152 0.29
153 0.32
154 0.3
155 0.36
156 0.41
157 0.48
158 0.48
159 0.51
160 0.5
161 0.54
162 0.58
163 0.57
164 0.6
165 0.59
166 0.64
167 0.66
168 0.69
169 0.67
170 0.72
171 0.74
172 0.69
173 0.66
174 0.6
175 0.58
176 0.53
177 0.53
178 0.43
179 0.35
180 0.3
181 0.3
182 0.33
183 0.32
184 0.31
185 0.28
186 0.37
187 0.42