Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X6N6H0

Protein Details
Accession A0A1X6N6H0    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-29TSHSKRHTKSHTLCRRCGNRAFHKQHKECHydrophilic
NLS Segment(s)
PositionSequence
47-70KAKRRKTTGTGRMRYLKHVSRRFK
Subcellular Location(s) nucl 17, cyto_nucl 12, mito 5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences TSHSKRHTKSHTLCRRCGNRAFHKQHKECAQCGYPSAKLRSYEWGQKAKRRKTTGTGRMRYLKHVSRRFKNGFRENTTAVKRTKSKPSEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.75
4 0.74
5 0.72
6 0.72
7 0.76
8 0.78
9 0.78
10 0.81
11 0.78
12 0.77
13 0.77
14 0.71
15 0.62
16 0.58
17 0.51
18 0.41
19 0.4
20 0.36
21 0.31
22 0.31
23 0.32
24 0.29
25 0.28
26 0.28
27 0.32
28 0.31
29 0.34
30 0.35
31 0.41
32 0.4
33 0.46
34 0.54
35 0.56
36 0.62
37 0.59
38 0.57
39 0.57
40 0.66
41 0.69
42 0.7
43 0.66
44 0.63
45 0.66
46 0.63
47 0.6
48 0.56
49 0.53
50 0.53
51 0.58
52 0.62
53 0.62
54 0.71
55 0.73
56 0.73
57 0.76
58 0.76
59 0.75
60 0.73
61 0.71
62 0.65
63 0.66
64 0.63
65 0.59
66 0.52
67 0.51
68 0.52
69 0.52
70 0.59