Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X6N903

Protein Details
Accession A0A1X6N903    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MHIKKLKVRPRKEHAKAVCGBasic
NLS Segment(s)
PositionSequence
9-11RPR
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MHIKKLKVRPRKEHAKAVCGVQLASMLGCWAASGDTHSVGPCQESAKALYECMRTAPLGGKQHGSTINYHLMRLGKILNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.77
3 0.69
4 0.62
5 0.54
6 0.44
7 0.36
8 0.26
9 0.21
10 0.14
11 0.11
12 0.08
13 0.05
14 0.04
15 0.04
16 0.04
17 0.03
18 0.03
19 0.03
20 0.05
21 0.05
22 0.06
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.06
29 0.07
30 0.07
31 0.07
32 0.09
33 0.13
34 0.13
35 0.13
36 0.16
37 0.17
38 0.16
39 0.17
40 0.16
41 0.12
42 0.13
43 0.16
44 0.19
45 0.23
46 0.24
47 0.26
48 0.25
49 0.29
50 0.32
51 0.3
52 0.25
53 0.25
54 0.32
55 0.3
56 0.3
57 0.29
58 0.27
59 0.26
60 0.26