Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X6ND28

Protein Details
Accession A0A1X6ND28    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
74-100IATPMDKRAPRRSHRCSNKPAVRRAFSHydrophilic
NLS Segment(s)
PositionSequence
37-42KRARKL
Subcellular Location(s) nucl 14, mito 7, cyto 6
Family & Domain DBs
Amino Acid Sequences MILIEILLGNRTGSASSSLLTICAKELLKCADPRGQKRARKLGRASSRGLEAPIVVYNDRARCMYRTRLSLTGIATPMDKRAPRRSHRCSNKPAVRRAFSLLLLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.11
5 0.11
6 0.12
7 0.12
8 0.11
9 0.08
10 0.12
11 0.12
12 0.12
13 0.15
14 0.18
15 0.22
16 0.23
17 0.25
18 0.28
19 0.35
20 0.39
21 0.46
22 0.51
23 0.51
24 0.58
25 0.66
26 0.65
27 0.66
28 0.66
29 0.66
30 0.67
31 0.66
32 0.6
33 0.51
34 0.46
35 0.39
36 0.34
37 0.24
38 0.14
39 0.11
40 0.1
41 0.09
42 0.07
43 0.08
44 0.1
45 0.11
46 0.12
47 0.12
48 0.12
49 0.14
50 0.18
51 0.25
52 0.27
53 0.3
54 0.33
55 0.35
56 0.35
57 0.36
58 0.33
59 0.28
60 0.24
61 0.21
62 0.18
63 0.16
64 0.16
65 0.19
66 0.2
67 0.23
68 0.32
69 0.42
70 0.51
71 0.61
72 0.68
73 0.74
74 0.82
75 0.86
76 0.85
77 0.87
78 0.87
79 0.85
80 0.85
81 0.84
82 0.77
83 0.71
84 0.67
85 0.6