Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X6MP22

Protein Details
Accession A0A1X6MP22    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
148-168KEPSPHVHKDKHRPLKCRGAHBasic
NLS Segment(s)
PositionSequence
59-69RGDRARVPRGR
Subcellular Location(s) cyto 18, cyto_nucl 11.5, nucl 3, mito 3
Family & Domain DBs
Amino Acid Sequences MGEDITGVGGDGGRCGGGGGCGGPPLVELREERVLERPLGGISSYLTGLGDSLGKAGGRGDRARVPRGRSRCKGASRAERMLCSADRLVAQVIFCDRSGCPVGARLLLTAVDDSLRAVWDVDVDEVLRVECVNLALAGSHVGWGEDGKEPSPHVHKDKHRPLKCRGAHHPTCGKGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.05
5 0.06
6 0.06
7 0.06
8 0.07
9 0.07
10 0.06
11 0.07
12 0.08
13 0.09
14 0.1
15 0.1
16 0.15
17 0.21
18 0.21
19 0.22
20 0.26
21 0.27
22 0.26
23 0.25
24 0.21
25 0.16
26 0.16
27 0.15
28 0.1
29 0.08
30 0.09
31 0.08
32 0.07
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.04
39 0.05
40 0.05
41 0.05
42 0.05
43 0.07
44 0.08
45 0.11
46 0.12
47 0.15
48 0.2
49 0.24
50 0.3
51 0.33
52 0.36
53 0.41
54 0.5
55 0.56
56 0.54
57 0.58
58 0.59
59 0.6
60 0.62
61 0.63
62 0.63
63 0.6
64 0.63
65 0.57
66 0.5
67 0.45
68 0.4
69 0.32
70 0.25
71 0.18
72 0.12
73 0.11
74 0.11
75 0.1
76 0.08
77 0.08
78 0.06
79 0.07
80 0.08
81 0.07
82 0.08
83 0.07
84 0.1
85 0.12
86 0.11
87 0.11
88 0.12
89 0.13
90 0.13
91 0.13
92 0.1
93 0.09
94 0.09
95 0.09
96 0.07
97 0.06
98 0.05
99 0.05
100 0.05
101 0.04
102 0.05
103 0.04
104 0.05
105 0.05
106 0.05
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.05
115 0.05
116 0.04
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.06
125 0.05
126 0.06
127 0.05
128 0.05
129 0.06
130 0.06
131 0.08
132 0.11
133 0.12
134 0.13
135 0.14
136 0.15
137 0.2
138 0.26
139 0.31
140 0.33
141 0.41
142 0.5
143 0.6
144 0.7
145 0.76
146 0.78
147 0.79
148 0.81
149 0.82
150 0.8
151 0.78
152 0.77
153 0.77
154 0.75
155 0.77
156 0.77