Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EH29

Protein Details
Accession H0EH29   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
37-57SQNRSWKTKKQNISKNKEAKKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, mito_nucl 14
Family & Domain DBs
Amino Acid Sequences MRVSRPRHAKTWGTFFLSLRDNIPFYSIVAHKLAFASQNRSWKTKKQNISKNKEAKKDALMSCDPSGESRTPDYSMSRVVIREFERTYDRGMKVGRCCSFSEKEGADRRLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.5
3 0.48
4 0.42
5 0.37
6 0.29
7 0.26
8 0.21
9 0.19
10 0.2
11 0.16
12 0.13
13 0.16
14 0.15
15 0.15
16 0.16
17 0.16
18 0.14
19 0.14
20 0.15
21 0.14
22 0.16
23 0.2
24 0.22
25 0.3
26 0.32
27 0.37
28 0.39
29 0.42
30 0.51
31 0.53
32 0.58
33 0.61
34 0.68
35 0.74
36 0.8
37 0.81
38 0.8
39 0.78
40 0.76
41 0.68
42 0.61
43 0.54
44 0.52
45 0.44
46 0.39
47 0.33
48 0.3
49 0.27
50 0.26
51 0.22
52 0.16
53 0.18
54 0.14
55 0.14
56 0.14
57 0.15
58 0.16
59 0.17
60 0.18
61 0.17
62 0.18
63 0.17
64 0.17
65 0.16
66 0.15
67 0.19
68 0.19
69 0.23
70 0.21
71 0.23
72 0.25
73 0.26
74 0.3
75 0.33
76 0.32
77 0.31
78 0.34
79 0.37
80 0.4
81 0.47
82 0.45
83 0.4
84 0.43
85 0.45
86 0.46
87 0.42
88 0.42
89 0.36
90 0.42
91 0.48