Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0ED75

Protein Details
Accession H0ED75    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
10-34GFLREKPTVAVKRKYKPRAAAVSKSHydrophilic
142-195TTPPPEKASKVPKKPRGRPPKSEKPAKPSKQPTTRKPRVPKAPKVPKVPKTKTPBasic
NLS Segment(s)
PositionSequence
8-27KKGFLREKPTVAVKRKYKPR
148-193KASKVPKKPRGRPPKSEKPAKPSKQPTTRKPRVPKAPKVPKVPKTK
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MIVLRGGKKGFLREKPTVAVKRKYKPRAAAVSKSYVEEATDSDEPTDDNVLPPAKRAKTVPFTIQMGDEDDEIEPLPATSLPPTSDTNTTAPLDQTALSDEANRQNIEQVMDSETRDKTSGATRSATPPLANSMQASQTPTTTPPPEKASKVPKKPRGRPPKSEKPAKPSKQPTTRKPRVPKAPKVPKVPKTKTPPPQATTATHLLKNSQLLITVRHKPRLGDVISLLSLLDPEKQAEATGDFACFEIKIIFLAKGRYTVMLCVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.59
3 0.65
4 0.66
5 0.65
6 0.66
7 0.67
8 0.71
9 0.78
10 0.81
11 0.8
12 0.79
13 0.8
14 0.81
15 0.8
16 0.79
17 0.74
18 0.72
19 0.64
20 0.57
21 0.49
22 0.38
23 0.31
24 0.23
25 0.18
26 0.17
27 0.17
28 0.16
29 0.15
30 0.15
31 0.14
32 0.15
33 0.16
34 0.11
35 0.1
36 0.13
37 0.16
38 0.16
39 0.19
40 0.26
41 0.25
42 0.27
43 0.29
44 0.33
45 0.37
46 0.42
47 0.43
48 0.4
49 0.4
50 0.39
51 0.37
52 0.3
53 0.26
54 0.22
55 0.17
56 0.13
57 0.11
58 0.11
59 0.1
60 0.09
61 0.06
62 0.05
63 0.06
64 0.05
65 0.06
66 0.06
67 0.07
68 0.08
69 0.11
70 0.13
71 0.15
72 0.17
73 0.19
74 0.19
75 0.21
76 0.21
77 0.19
78 0.17
79 0.15
80 0.14
81 0.11
82 0.1
83 0.09
84 0.09
85 0.09
86 0.09
87 0.11
88 0.14
89 0.17
90 0.16
91 0.15
92 0.15
93 0.16
94 0.17
95 0.15
96 0.12
97 0.12
98 0.13
99 0.14
100 0.15
101 0.14
102 0.14
103 0.14
104 0.13
105 0.11
106 0.15
107 0.19
108 0.18
109 0.19
110 0.19
111 0.22
112 0.24
113 0.24
114 0.18
115 0.15
116 0.16
117 0.16
118 0.15
119 0.12
120 0.11
121 0.11
122 0.12
123 0.14
124 0.1
125 0.1
126 0.1
127 0.12
128 0.14
129 0.15
130 0.16
131 0.17
132 0.22
133 0.25
134 0.26
135 0.31
136 0.39
137 0.46
138 0.55
139 0.62
140 0.67
141 0.74
142 0.81
143 0.85
144 0.86
145 0.85
146 0.85
147 0.85
148 0.86
149 0.85
150 0.86
151 0.8
152 0.77
153 0.8
154 0.75
155 0.75
156 0.73
157 0.74
158 0.74
159 0.78
160 0.8
161 0.8
162 0.84
163 0.83
164 0.83
165 0.83
166 0.84
167 0.85
168 0.84
169 0.84
170 0.87
171 0.85
172 0.86
173 0.86
174 0.83
175 0.85
176 0.81
177 0.79
178 0.77
179 0.79
180 0.78
181 0.79
182 0.79
183 0.7
184 0.7
185 0.65
186 0.59
187 0.54
188 0.52
189 0.45
190 0.39
191 0.36
192 0.31
193 0.3
194 0.28
195 0.24
196 0.17
197 0.17
198 0.16
199 0.21
200 0.26
201 0.33
202 0.37
203 0.41
204 0.42
205 0.4
206 0.44
207 0.47
208 0.42
209 0.36
210 0.33
211 0.3
212 0.29
213 0.28
214 0.23
215 0.14
216 0.13
217 0.1
218 0.11
219 0.08
220 0.09
221 0.1
222 0.11
223 0.11
224 0.12
225 0.13
226 0.14
227 0.14
228 0.13
229 0.12
230 0.12
231 0.13
232 0.11
233 0.11
234 0.08
235 0.08
236 0.09
237 0.1
238 0.12
239 0.14
240 0.18
241 0.18
242 0.21
243 0.22
244 0.23
245 0.22