Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X6MYJ7

Protein Details
Accession A0A1X6MYJ7    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
48-67ASPPRSPRSHPHKRGQSRASHydrophilic
NLS Segment(s)
PositionSequence
51-62PRSPRSHPHKRG
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSSPVAIPRTERTARDLTPSSGSPTGLYVPVHKRNASAASSLTSERPASPPRSPRSHPHKRGQSRASLAPSHASPVPSASPRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.42
3 0.4
4 0.35
5 0.35
6 0.34
7 0.33
8 0.28
9 0.28
10 0.21
11 0.19
12 0.18
13 0.16
14 0.15
15 0.15
16 0.21
17 0.28
18 0.31
19 0.3
20 0.29
21 0.3
22 0.33
23 0.29
24 0.23
25 0.16
26 0.15
27 0.16
28 0.16
29 0.14
30 0.12
31 0.11
32 0.11
33 0.13
34 0.16
35 0.19
36 0.25
37 0.32
38 0.37
39 0.43
40 0.46
41 0.53
42 0.59
43 0.66
44 0.69
45 0.71
46 0.76
47 0.78
48 0.84
49 0.79
50 0.77
51 0.71
52 0.69
53 0.63
54 0.55
55 0.47
56 0.41
57 0.37
58 0.32
59 0.29
60 0.24
61 0.19
62 0.2
63 0.24