Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X6NA84

Protein Details
Accession A0A1X6NA84    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-64VTRGAGFRKEKNKKKRGSYRGGEISBasic
NLS Segment(s)
PositionSequence
45-56GFRKEKNKKKRG
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences QRVKPDTVQFLDERLRDNRFEARGGVEDDYGHRAARDLIVTRGAGFRKEKNKKKRGSYRGGEISVCIRVPHLDIYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.28
4 0.31
5 0.33
6 0.29
7 0.29
8 0.26
9 0.24
10 0.24
11 0.25
12 0.22
13 0.16
14 0.15
15 0.14
16 0.17
17 0.14
18 0.12
19 0.1
20 0.09
21 0.09
22 0.1
23 0.1
24 0.08
25 0.09
26 0.1
27 0.1
28 0.1
29 0.13
30 0.12
31 0.14
32 0.16
33 0.21
34 0.31
35 0.41
36 0.51
37 0.59
38 0.68
39 0.73
40 0.82
41 0.86
42 0.85
43 0.85
44 0.82
45 0.8
46 0.79
47 0.73
48 0.62
49 0.52
50 0.45
51 0.38
52 0.32
53 0.22
54 0.15
55 0.14
56 0.16