Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X6NGD2

Protein Details
Accession A0A1X6NGD2    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
163-185WQEMRCPRTGRIEKRKCAKPEGLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.5, cyto 10.5, mito 9, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039771  Csl4  
IPR019495  EXOSC1_C  
IPR012340  NA-bd_OB-fold  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0000178  C:exosome (RNase complex)  
GO:0003723  F:RNA binding  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF10447  EXOSC1  
Amino Acid Sequences MSSDLVLPGQPIPLPRGPVPQLAGGIYSRDGHVRASLVGVPRYEGSALAIPRTRPHPPSPDSTVLGFVSRLSPQQAVLSITVVDGVPLPPGEEFTGVIRVQDVRATEKDKVKIADCFRGGDVVKGLVISLGDARSYYVTTARNDLGVIFATSEAGVTMEPVSWQEMRCPRTGRIEKRKCAKPEGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.31
4 0.32
5 0.35
6 0.36
7 0.33
8 0.3
9 0.26
10 0.26
11 0.19
12 0.18
13 0.15
14 0.13
15 0.12
16 0.13
17 0.13
18 0.12
19 0.13
20 0.13
21 0.12
22 0.13
23 0.15
24 0.17
25 0.18
26 0.17
27 0.17
28 0.16
29 0.17
30 0.15
31 0.13
32 0.11
33 0.14
34 0.14
35 0.15
36 0.17
37 0.17
38 0.19
39 0.24
40 0.26
41 0.26
42 0.31
43 0.36
44 0.37
45 0.43
46 0.47
47 0.46
48 0.44
49 0.4
50 0.37
51 0.29
52 0.26
53 0.2
54 0.14
55 0.11
56 0.1
57 0.1
58 0.1
59 0.1
60 0.1
61 0.1
62 0.11
63 0.11
64 0.1
65 0.1
66 0.08
67 0.08
68 0.08
69 0.07
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.08
88 0.1
89 0.1
90 0.1
91 0.12
92 0.16
93 0.2
94 0.24
95 0.26
96 0.27
97 0.28
98 0.27
99 0.31
100 0.31
101 0.33
102 0.29
103 0.29
104 0.26
105 0.28
106 0.26
107 0.21
108 0.18
109 0.12
110 0.11
111 0.1
112 0.09
113 0.06
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.07
122 0.07
123 0.08
124 0.1
125 0.13
126 0.15
127 0.18
128 0.18
129 0.18
130 0.17
131 0.17
132 0.14
133 0.12
134 0.11
135 0.08
136 0.07
137 0.07
138 0.07
139 0.07
140 0.06
141 0.05
142 0.04
143 0.05
144 0.05
145 0.05
146 0.06
147 0.06
148 0.1
149 0.11
150 0.12
151 0.19
152 0.26
153 0.29
154 0.35
155 0.39
156 0.39
157 0.48
158 0.58
159 0.61
160 0.65
161 0.73
162 0.76
163 0.82
164 0.88
165 0.83